SCOPe 2.08: Structural Classification of Proteins

PDB entry 5hys

View 5hys on RCSB PDB site
Description: Structure of IgE complexed with omalizumab
Class: immune system
Keywords: immune system
Deposited on 2016-02-01, released 2016-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Epididymis luminal protein 214
Species: Homo sapiens [TaxId:9606]
Gene: HEL-214
Database cross-references and differences (RAF-indexed):
- PDB 5HYS (0-221)
Domains in SCOPe 2.08: d5hysa_
Chain 'B':
Compound: Uncharacterized protein
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 5HYS (0-End)
Domains in SCOPe 2.08: d5hysb1, d5hysb2
Chain 'C':
Compound: Epididymis luminal protein 214
Species: Homo sapiens [TaxId:9606]
Gene: HEL-214
Database cross-references and differences (RAF-indexed):
- PDB 5HYS (0-221)
Domains in SCOPe 2.08: d5hysc_
Chain 'D':
Compound: Uncharacterized protein
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 5HYS (0-End)
Domains in SCOPe 2.08: d5hysd1, d5hysd2
Chain 'E':
Compound: Epididymis luminal protein 214
Species: Homo sapiens [TaxId:9606]
Gene: HEL-214
Database cross-references and differences (RAF-indexed):
- PDB 5HYS (0-221)
Domains in SCOPe 2.08: d5hyse_
Chain 'F':
Compound: Uncharacterized protein
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 5HYS (0-End)
Domains in SCOPe 2.08: d5hysf1, d5hysf2
Chain 'G':
Compound: ig epsilon chain c region
Species: Homo sapiens [TaxId:9606]
Gene: IGHE
Database cross-references and differences (RAF-indexed):
- Uniprot P01854
  - engineered mutation (10)
Domains in SCOPe 2.08: d5hysg1, d5hysg2
Chain 'H':
Compound: Epididymis luminal protein 214
Species: Homo sapiens [TaxId:9606]
Gene: HEL-214
Database cross-references and differences (RAF-indexed):
- PDB 5HYS (0-221)
Domains in SCOPe 2.08: d5hysh_
Chain 'I':
Compound: ig epsilon chain c region
Species: Homo sapiens [TaxId:9606]
Gene: IGHE
Database cross-references and differences (RAF-indexed):
- Uniprot P01854
  - engineered mutation (10)
Domains in SCOPe 2.08: d5hysi1, d5hysi2
Chain 'J':
Compound: ig epsilon chain c region
Species: Homo sapiens [TaxId:9606]
Gene: IGHE
Database cross-references and differences (RAF-indexed):
- Uniprot P01854
  - engineered mutation (10)
Domains in SCOPe 2.08: d5hysj1, d5hysj2
Chain 'K':
Compound: ig epsilon chain c region
Species: Homo sapiens [TaxId:9606]
Gene: IGHE
Database cross-references and differences (RAF-indexed):
- Uniprot P01854
  - engineered mutation (10)
Domains in SCOPe 2.08: d5hysk1, d5hysk2
Chain 'L':
Compound: Uncharacterized protein
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 5HYS (0-End)
Domains in SCOPe 2.08: d5hysl1, d5hysl2
Heterogens: SO4, HOH

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)

>5hysA (A:)
evqlvesggglvqpggslrlscavsgysitsgyswnwirqapgkglewvasitydgstny
npsvkgritisrddskntfylqmnslraedtavyycargshyfghwhfavwgqgtlvtvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Chain 'B':
Sequence, based on SEQRES records: (download)

>5hysB (B:)
diqltqspsslsasvgdrvtitcrasqsvdydgdsymnwyqqkpgkapklliyaasyles
gvpsrfsgsgsgtdftltisslqpedfatyycqqshedpytfgqgtkveikrtvaapsvf
ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
stltlskadyekhkvyacevthqglsspvtksfnrgec