PDB entry 5hym

View 5hym on RCSB PDB site
Description: 3-hydroxybenzoate 6-hydroxylase from rhodococcus jostii in complex with phosphatidylinositol
Deposited on 2016-02-01, released 2017-02-01
The last revision was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable salicylate monooxygenase
    Species: Rhodococcus jostii (strain RHA1) [TaxId:101510]
    Gene: RHA1_ro01869
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FAD, T7X, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hymA (A:)
    msnlqdariiiagggiggaanalalaqkganvtlferasefgevgaglqvgphgarilds
    wgvlddvlsraflpknivfrdaitaevltkidlgsefrgryggpyfvthrsdlhatlvda
    araagaelhtgvtvtdvitegdkaivstddgrtheadialgmdglksrlrekisgdepvs
    sgyaayrgttpyrdveldediedvvgyigprchfiqyplrggemlnqvavfespgfkngi
    enwggpeeleqayahchenvrrgidylwkdrwwpmydrepienwvdgrmillgdaahppl
    qylasgavmaiedakcladyaaedfstggnsawpqilkevnteraprcnrilttgrmwge
    lwhldgtariarnelfrtrdtssykytdwlwgyssdrasklgpeqkliseedlnsavdhh
    hhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hymA (A:)
    nlqdariiiagggiggaanalalaqkganvtlferasefgevgaglqvgphgarildswg
    vlddvlsraflpknivfrdaitaevltkidlgsefrgryggpyfvthrsdlhatlvdaar
    aagaelhtgvtvtdvitegdkaivstddgrtheadialgmdglksrlrekisgdepvssg
    yaayrgttpyrdveldediedvvgyigprchfiqyplrggemlnqvavfespgfkngien
    wggpeeleqayahchenvrrgidylwkdrwwpmydrepienwvdgrmillgdaahpplqy
    lasgavmaiedakcladyaaedfstggnsawpqilkevnteraprcnrilttgrmwgelw
    hldgtariarnelfrtrdtssykytdwlwgyssdr