PDB entry 5hyd

View 5hyd on RCSB PDB site
Description: Crystal structure of calcium-free human S100Z
Class: protein binding
Keywords: S100, calcium-promoted oligomerisation neuronal development, protein binding
Deposited on 2016-02-01, released 2017-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-Z
    Species: Homo sapiens [TaxId:9606]
    Gene: S100Z
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hyda_
  • Chain 'B':
    Compound: Protein S100-Z
    Species: Homo sapiens [TaxId:9606]
    Gene: S100Z
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hydb_
  • Chain 'C':
    Compound: Protein S100-Z
    Species: Homo sapiens [TaxId:9606]
    Gene: S100Z
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hydc_
  • Chain 'D':
    Compound: Protein S100-Z
    Species: Homo sapiens [TaxId:9606]
    Gene: S100Z
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hydd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hydA (A:)
    mptqlemamdtmirifhrysgkerkrfklskgelklllqrelteflscqketqlvdkivq
    dldankdnevdfnefvvmvaaltvacndyfveqlkkkgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hydA (A:)
    ptqlemamdtmirifhrysgkerkrfklskgelklllqrelteflscqketqlvdkivqd
    ldankdnevdfnefvvmvaaltvacndyfveqlkkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hydB (B:)
    mptqlemamdtmirifhrysgkerkrfklskgelklllqrelteflscqketqlvdkivq
    dldankdnevdfnefvvmvaaltvacndyfveqlkkkgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hydB (B:)
    ptqlemamdtmirifhrysgkerkrfklskgelklllqrelteflscqketqlvdkivqd
    ldankdnevdfnefvvmvaaltvacndyfveqlkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hydC (C:)
    mptqlemamdtmirifhrysgkerkrfklskgelklllqrelteflscqketqlvdkivq
    dldankdnevdfnefvvmvaaltvacndyfveqlkkkgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hydC (C:)
    ptqlemamdtmirifhrysgkerkrfklskgelklllqrelteflscqketqlvdkivqd
    ldankdnevdfnefvvmvaaltvacndyfveqlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hydD (D:)
    mptqlemamdtmirifhrysgkerkrfklskgelklllqrelteflscqketqlvdkivq
    dldankdnevdfnefvvmvaaltvacndyfveqlkkkgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hydD (D:)
    ptqlemamdtmirifhrysgkerkrfklskgelklllqrelteflscqketqlvdkivqd
    ldankdnevdfnefvvmvaaltvacndyfveqlkkk