PDB entry 5hy3

View 5hy3 on RCSB PDB site
Description: crystal structure of escherichia coli toxin lsoa in complex with t4 phage antitoxin dmd
Deposited on 2016-02-01, released 2016-06-22
The last revision was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA endoribonuclease LsoA
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: lsoA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Antitoxin Dmd
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: dmd, 61.5, y02B
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hy3A (A:)
    maqnpfkalninidkiesaltqngvtnyssnvknerethisgtykgidfliklmpsggnt
    tigrasgqnntyfdeialiikenclysdtknfeytipkfsdddranlfeflseegitite
    dnnndpnckhqyimttsngdrvrakiykrgsiqfqgkylqiaslindfmcsilnmkeive
    qknkefnvdikketieselhsklpksidkihedikkqlscslimkkidvemedystycfs
    alraiegfiyqilndvcnpsssknlgeyftenkpkyiireihqetingeiaevlcecyty
    whenrhglfhmkpgiadtktinklesiaiidtvcqlidggvarlkl
    

    Sequence, based on observed residues (ATOM records):
    >5hy3A (A:)
    knfeytipkfsdddranlfeflseegititednnndpnckhqyimttsngdrvrakisiq
    fqgkylqiaslindfmcsilnmkeiveqknkefnvdikketieselhsklpksidkihed
    ikkqlscslimkkidvemedystycfsalraiegfiyqilndvcnpsssknlgeyftenk
    pkyiireihqetingeiaevlcecytywhenrhglfhmkpgiadtktinklesiaiidtv
    cqlidggvarlk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hy3B (B:)
    melvkvvfmgwfknesmftkeitmmkddvqwattqyaevnkalvkafiddkkvcevdcrg
    

    Sequence, based on observed residues (ATOM records):
    >5hy3B (B:)
    lvkvvfmgwfknesmftkeitmmkddvqwattqyaevnkalvkafiddkkvcevdcr