PDB entry 5hy2

View 5hy2 on RCSB PDB site
Description: structure-function analysis of functionally diverse members of the cyclic amide hydrolase family of toblerone fold enzymes
Deposited on 2016-02-01, released 2017-02-01
The last revision was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ring-opening amidohydrolase
    Species: Frankia sp. Eul1b [TaxId:985774]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ring-opening amidohydrolase
    Species: Frankia sp. Eul1b [TaxId:985774]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hy2A (A:)
    mgsshhhhhhssglvprgshmpnpeaslsprsarypkasmhvvpmlapndtaafralfas
    gavdpasvvaliaksegsglhndharvfadvslrtalaeargcpvedladsvtvavsggs
    pgvisphvtvvtqewvadlpaglpgvglvvgrghtepilpedigrtaqvdkvadavaaam
    ldagvtdpddvhlvmvkgpalssravadalsrgktvvtgdygigpmgsmcwsndasalgv
    avalgevkrdlvaddrirsdwdlfsavaatssggekrggevlllansaqsaselrighgi
    trdmadtegiktairtagvdfdcclspaqqaqvvqvfgkfvlpgsdvlrgqhitalddhe
    ahhvakavggalvvsitgqpmsfisggernshmgppggnpvaavvrrlpa
    

    Sequence, based on observed residues (ATOM records):
    >5hy2A (A:)
    arypkasmhvvpmlapndtaafralfasgavdpasvvaliaksegsglhndharvfadvs
    lrtalaeargcpvedladsvtvavsggspgvisphvtvvtqewvadlpaglpgvglvvgr
    ghtepilpedigrtaqvdkvadavaaamldagvtdpddvhlvmvkgpalcwsndasalgv
    avalgevkrdllfsavaatssggekrggevlllansaqsaselrighgitrdmadtegik
    tairtagvdfdcclspaqqaqvvqvfgkfvlpgsdvlrgqhitalddheahhvakavgga
    lvvsitgqpmsfisggernsgppggnpvaavvrrlpa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hy2B (B:)
    mgsshhhhhhssglvprgshmpnpeaslsprsarypkasmhvvpmlapndtaafralfas
    gavdpasvvaliaksegsglhndharvfadvslrtalaeargcpvedladsvtvavsggs
    pgvisphvtvvtqewvadlpaglpgvglvvgrghtepilpedigrtaqvdkvadavaaam
    ldagvtdpddvhlvmvkgpalssravadalsrgktvvtgdygigpmgsmcwsndasalgv
    avalgevkrdlvaddrirsdwdlfsavaatssggekrggevlllansaqsaselrighgi
    trdmadtegiktairtagvdfdcclspaqqaqvvqvfgkfvlpgsdvlrgqhitalddhe
    ahhvakavggalvvsitgqpmsfisggernshmgppggnpvaavvrrlpa
    

    Sequence, based on observed residues (ATOM records):
    >5hy2B (B:)
    rypkasmhvvpmlapndtaafralfasgavdpasvvaliaksegsglhndharvfadvsl
    rtalaeargcpvedladsvtvavsggspgvisphvtvvtqewvadlpaglpgvglvvgrg
    htepilpedigrtaqvdkvadavaaamldagvtdpddvhlvmvkgpalcwsndasalgva
    valgevkrlfsavaatssggekrggevlllansaqsaselrighgitrdmadtegiktai
    rtagvdfdcclspaqqaqvvqvfgkfvlpgsdvlrgqhitalddheahhvakavggalvv
    sitgqpmsfisggernggnpvaavvrrlpa