PDB entry 5hxz

View 5hxz on RCSB PDB site
Description: structure-function analysis of functionally diverse members of the cyclic amide hydrolase family of toblerone fold enzymes
Deposited on 2016-01-31, released 2017-02-01
The last revision was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Barbiturase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: bar
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RSQ2
      • conflict (306)
  • Chain 'B':
    Compound: Barbiturase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: bar
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RSQ2
      • conflict (306)
  • Chain 'C':
    Compound: Barbiturase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: bar
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RSQ2
      • conflict (306)
  • Chain 'D':
    Compound: Barbiturase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: bar
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RSQ2
      • conflict (306)
  • Heterogens: CL, MHA, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hxzA (A:)
    mgsshhhhhhssglvprgshmpeaievrkvplhsvsdaselakliddgvleadrviavig
    ktegnggvndytriiadrafrevlsakgnrspeevaevpivwsggtdgvisphatifatv
    padkvtktdeprltvgvamseqllpedigrtamitkvaaavkdamadagitdpadvhyvq
    tktplltihtirdaksrgktvwteqthesmdlsnggtalgiavalgeidmptdedvmhsr
    elfssvascssgveldraqivvvgnargvggryrighsvmkdpldqdgiwaairdaglel
    perphssdldgqlvnvflkceasqdgtvrgrrnamlddsdvhwhrqikscvggvtaavtg
    dpavfvsvsaahqgpegggpvaaivdlgq
    

    Sequence, based on observed residues (ATOM records):
    >5hxzA (A:)
    peaievrkvplhsvsdaselakliddgvleadrviavigktegnggvndytriiadrafr
    evlsakgnrspeevaevpivwsggtdgvisphatifatvpadkvtktdeprltvgvamse
    qllpedigrtamitkvaaavkdamadagitdpadvhyvqtktplltihtirdaksrgktv
    wteqthesmdlsnggtalgiavalgeidmptdedvmhsrelfssvascssgveldraqiv
    vvgnargvggryrighsvmkdpldqdgiwaairdaglelperphssdldgqlvnvflkce
    asqdgtvrgrrnamlddsdvhwhrqikscvggvtaavtgdpavfvsvsaahqgpegggpv
    aaivdlg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hxzB (B:)
    mgsshhhhhhssglvprgshmpeaievrkvplhsvsdaselakliddgvleadrviavig
    ktegnggvndytriiadrafrevlsakgnrspeevaevpivwsggtdgvisphatifatv
    padkvtktdeprltvgvamseqllpedigrtamitkvaaavkdamadagitdpadvhyvq
    tktplltihtirdaksrgktvwteqthesmdlsnggtalgiavalgeidmptdedvmhsr
    elfssvascssgveldraqivvvgnargvggryrighsvmkdpldqdgiwaairdaglel
    perphssdldgqlvnvflkceasqdgtvrgrrnamlddsdvhwhrqikscvggvtaavtg
    dpavfvsvsaahqgpegggpvaaivdlgq
    

    Sequence, based on observed residues (ATOM records):
    >5hxzB (B:)
    eaievrkvplhsvsdaselakliddgvleadrviavigktegnggvndytriiadrafre
    vlsakgnrspeevaevpivwsggtdgvisphatifatvpadkvtktdeprltvgvamseq
    llpedigrtamitkvaaavkdamadagitdpadvhyvqtktplltihtirdaksrgktvw
    teqthesmdlsnggtalgiavalgeidmptdedvmhsrelfssvascssgveldraqivv
    vgnargvggryrighsvmkdpldqdgiwaairdaglelperphssdldgqlvnvflkcea
    sqdgtvrgrrnamlddsdvhwhrqikscvggvtaavtgdpavfvsvsaahqgpegggpva
    aivdlg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hxzC (C:)
    mgsshhhhhhssglvprgshmpeaievrkvplhsvsdaselakliddgvleadrviavig
    ktegnggvndytriiadrafrevlsakgnrspeevaevpivwsggtdgvisphatifatv
    padkvtktdeprltvgvamseqllpedigrtamitkvaaavkdamadagitdpadvhyvq
    tktplltihtirdaksrgktvwteqthesmdlsnggtalgiavalgeidmptdedvmhsr
    elfssvascssgveldraqivvvgnargvggryrighsvmkdpldqdgiwaairdaglel
    perphssdldgqlvnvflkceasqdgtvrgrrnamlddsdvhwhrqikscvggvtaavtg
    dpavfvsvsaahqgpegggpvaaivdlgq
    

    Sequence, based on observed residues (ATOM records):
    >5hxzC (C:)
    peaievrkvplhsvsdaselakliddgvleadrviavigktegnggvndytriiadrafr
    evlsakgnrspeevaevpivwsggtdgvisphatifatvpadkvtktdeprltvgvamse
    qllpedigrtamitkvaaavkdamadagitdpadvhyvqtktplltihtirdaksrgktv
    wteqthesmdlsnggtalgiavalgeidmptdedvmhsrelfssvascssgveldraqiv
    vvgnargvggryrighsvmkdpldqdgiwaairdaglelperphssdldgqlvnvflkce
    asqdgtvrgrrnamlddsdvhwhrqikscvggvtaavtgdpavfvsvsaahqgpegggpv
    aaivdlg
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hxzD (D:)
    mgsshhhhhhssglvprgshmpeaievrkvplhsvsdaselakliddgvleadrviavig
    ktegnggvndytriiadrafrevlsakgnrspeevaevpivwsggtdgvisphatifatv
    padkvtktdeprltvgvamseqllpedigrtamitkvaaavkdamadagitdpadvhyvq
    tktplltihtirdaksrgktvwteqthesmdlsnggtalgiavalgeidmptdedvmhsr
    elfssvascssgveldraqivvvgnargvggryrighsvmkdpldqdgiwaairdaglel
    perphssdldgqlvnvflkceasqdgtvrgrrnamlddsdvhwhrqikscvggvtaavtg
    dpavfvsvsaahqgpegggpvaaivdlgq
    

    Sequence, based on observed residues (ATOM records):
    >5hxzD (D:)
    peaievrkvplhsvsdaselakliddgvleadrviavigktegnggvndytriiadrafr
    evlsakgnrspeevaevpivwsggtdgvisphatifatvpadkvtktdeprltvgvamse
    qllpedigrtamitkvaaavkdamadagitdpadvhyvqtktplltihtirdaksrgktv
    wteqthesmdlsnggtalgiavalgeidmptdedvmhsrelfssvascssgveldraqiv
    vvgnargvggryrighsvmkdpldqdgiwaairdaglelperphssdldgqlvnvflkce
    asqdgtvrgrrnamlddsdvhwhrqikscvggvtaavtgdpavfvsvsaahqgpegggpv
    aaivdlg