PDB entry 5hxt

View 5hxt on RCSB PDB site
Description: Crystal Structure of Z,Z-Farnesyl Diphosphate Synthase (D71M, E75A and H103Y Mutants) Complexed with IPP and DMSPP
Class: transferase
Keywords: prenyltransferase, TRANSFERASE
Deposited on 2016-01-31, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (2Z,6Z)-farnesyl diphosphate synthase, chloroplastic
    Species: Solanum habrochaites [TaxId:62890]
    Gene: ZFPS
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8XA40
      • engineered mutation (32)
    Domains in SCOPe 2.07: d5hxta_
  • Chain 'B':
    Compound: (2Z,6Z)-farnesyl diphosphate synthase, chloroplastic
    Species: Solanum habrochaites [TaxId:62890]
    Gene: ZFPS
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8XA40 (1-End)
      • initiating methionine (0)
      • engineered mutation (4)
      • engineered mutation (32)
    Domains in SCOPe 2.07: d5hxtb_
  • Heterogens: MG, DST, IPR, O4B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hxtA (A:)
    mldealmpkhialimdgnrrwakdkgldvsegykhlfpklkeicdissklgiqvitafaf
    stenwkrakgevdflmqmfeelydefsrsgvrvsiigcktdlpmtlqkcialteettkgn
    kglhlvialnyggyydilqatksivnkamnglldvedinknlfdqeleskcpnpdllirt
    ggdqrvsnfllwqlaytefyftktlfpdfgeedlkeaiinfqqrhrrfgghty
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hxtA (A:)
    lmpkhialimdgnrrwakdkgldvsegykhlfpklkeicdissklgiqvitafafstenw
    krakgevdflmqmfeelydefsrsgvrvsiigcktdlpmtlqkcialteettkgnkglhl
    vialnyggyydilqatksivnkamnglldvedinknlfdqeleskcpnpdllirtggdqr
    vsnfllwqlaytefyftktlfpdfgeedlkeaiinfqqrhr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hxtB (B:)
    mldealmpkhialimdgnrrwakdkgldvsegykhlfpklkeicdissklgiqvitafaf
    stenwkrakgevdflmqmfeelydefsrsgvrvsiigcktdlpmtlqkcialteettkgn
    kglhlvialnyggyydilqatksivnkamnglldvedinknlfdqeleskcpnpdllirt
    ggdqrvsnfllwqlaytefyftktlfpdfgeedlkeaiinfqqrhrrfgghty
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hxtB (B:)
    mldealmpkhialimdgnrrwakdkgldvsegykhlfpklkeicdissklgiqvitafaf
    stenwkrakgevdflmqmfeelydefsrsgvrvsiigcktdlpmtlqkcialteettkgn
    kglhlvialnyggyydilqatksivnkamnglldvedinknlfdqeleskcpnpdllirt
    ggdqrvsnfllwqlaytefyftktlfpdfgeedlkeaiinfqqrhr