PDB entry 5hxs

View 5hxs on RCSB PDB site
Description: structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 10mm sr2+
Deposited on 2016-01-31, released 2016-05-11
The last revision was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sodium,calcium exchanger
    Species: Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) [TaxId:243232]
    Gene: MJ0091
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57556 (0-299)
      • engineered mutation (1)
  • Heterogens: SR, MYS, TOE, OLC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hxsA (A:)
    mvilgvgyfllglillyygsdwfvlgseriarhfnvsnfvigatvmaigtslpeiltsay
    asymhapgisignaigscicniglvlglsaiispiivdknlqknilvyllfvifaavigi
    dgfswidgvvllilfiiylrwtvkngsaeieenndknnpsvvfslvlliigligvlvgae
    lfvdgakkialaldisdkvigftlvafgtslpelmvslaaakrnlggmvlgnvigsniad
    iggalavgslfmhlpaenvqmavlvimslllylfakyskigrwqgilflalyiiaiaslr
    

    Sequence, based on observed residues (ATOM records):
    >5hxsA (A:)
    mvilgvgyfllglillyygsdwfvlgseriarhfnvsnfvigatvmaigtslpeiltsay
    asymhapgisignaigscicniglvlglsaiispiivdknlqknilvyllfvifaavigi
    dgfswidgvvllilfiiylrwtvkngsaeieennpsvvfslvlliigligvlvgaelfvd
    gakkialaldisdkvigftlvafgtslpelmvslaaakrnlggmvlgnvigsniadigga
    lavgslfmhlpaenvqmavlvimslllylfakyskigrwqgilflalyiiaiaslr