PDB entry 5hxm

View 5hxm on RCSB PDB site
Description: cycloalternan-forming enzyme from listeria monocytogenes in complex with panose
Deposited on 2016-01-31, released 2017-01-25
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-xylosidase
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: yicI_4, ABE87_12155, ARD00_02746
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, CA, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hxmA (A:)
    mhhhhhhssgvdlgtenlyfqsnamdgeyhspygdddlytvqptersprdpkagedviln
    ittwpiengqdvwvewtkngvaqenvtaaydynsgnntywkadlgkfekgdeityttkgs
    tnggtayesgpftfyvtdweyvqdvtsvvdngdsitlnmtatagdfspklylsfedldtl
    rmelsptgketghagksgytvedtaekvtvttedlsieiqkspyrmevhqadgtlltsey
    ttanslgwltdgknvinqyqnnfmtpsdeafygfgerydtinqrgkdvetyvyneyqdqa
    qtertylavpffvsankygmyvnsdfhsqfqmaskvedkysfvldndgdmtnmldyyvis
    gkdqndivnnytditgkttllpkwafglwmsanewdresdvssalsnakandipatgfvl
    eqwsdeetyyiwnnatytakkngeafsyddftfngkwtdpkgmvdsvhdagmnivlwqvp
    vlkddgtvyeqrdndeeymisqgysaddgtgapyrvpasqwfgngilldftnkdavdwwt
    sqreylltevgidgfktdggemvwgrdttfsngekgqemrnryptdyvssyfdfaksinp
    eavsfsrsgtsgaqksgiywsgdqtstfdsfqaslkaglsastsgvsywawdmagftgdy
    ptaelykratamaafapimqfhseksdpspseerspwnavartgdetilptfqkylytrm
    nllpyiytaakdtadngksmmrqmamdypedvnardldeqymfgddllvapivqegqtek
    evylpegewvdiwnggvhpggetisyyadvdtlpvfakagaiipmnmtdgyqlgqnvgnd
    lksydnltfrvypsgdseysfyddvnggemrdisvsedfanekvsvdlpamadettmqvf
    steptsvtidgadvakadtldafneattgyyydtvqnltyvkaaakdakqaivlngvnha
    pyeaefghltnvttasdhagytgtgfvagfdaekeavefdidavdgasdytmevrysagv
    edatrtvyingkkqqitlpktanwdtwntvevpvtlqagnnqvvfdfeaddtaginfdhv
    vikk
    

    Sequence, based on observed residues (ATOM records):
    >5hxmA (A:)
    mdgeyhspygdddlytvqptersprdpkagedvilnittwpiengqdvwvewtkngvaqe
    nvtaaydynsgnntywkadlgkfekgdeityttkgstnggtayesgpftfyvtdweyvqd
    vtsvvdngdsitlnmtatagdfspklylsfedldtlrmelsptgketghagksgytvedt
    aekvtvttedlsieiqkspyrmevhqadgtlltseyttanslgwltdgknvinqyqnnfm
    tpsdeafygfgerydtinqrgkdvetyvyneyqdqaqtertylavpffvsankygmyvns
    dfhsqfqmaskvedkysfvldndgdmtnmldyyvisgkdqndivnnytditgkttllpkw
    afglwmsanewdresdvssalsnakandipatgfvleqwsdeetyyiwnnatytakknge
    afsyddftfngkwtdpkgmvdsvhdagmnivlwqvpvlkddgtvyeqrdndeeymisqgy
    saddgtgapyrvpasqwfgngilldftnkdavdwwtsqreylltevgidgfktdggemvw
    grdttfsngekgqemrnryptdyvssyfdfaksinpeavsfsrsgtsgaqksgiywsgdq
    tstfdsfqaslkaglsastsgvsywawdmagftgdyptaelykratamaafapimqfhse
    ksdpspseerspwnavartgdetilptfqkylytrmnllpyiytaakdtadngksmmrqm
    amdypedvnardldeqymfgddllvapivqegqtekevylpegewvdiwnggvhpggeti
    syyadvdtlpvfakagaiipmnmtdgyqlgqnvgndlksydnltfrvypsgdseysfydd
    vnggemrdisvsedfanekvsvdlpamadettmqvfsteptsvtidgadvakadtldafn
    eattgyyydtvqnltyvkaaakdakqaivlngvnhapyeaefghltnvttasdhagytgt
    gfvagfdaekeavefdidavdgasdytmevrysagvedatrtvyingkkqqitlpktanw
    dtwntvevpvtlqagnnqvvfdfeaddtaginfdhvvikk