PDB entry 5hxf

View 5hxf on RCSB PDB site
Description: Crystal structure of 3C protease from a mild Human enterovirus 71 in complex with rupintrivir
Class: hydrolase
Keywords: enterovirus, HYDROLASE
Deposited on 2016-01-30, released 2017-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C protease
    Species: Enterovirus A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3PZC0 (1-End)
      • expression tag (0)
      • conflict (69)
    Domains in SCOPe 2.07: d5hxfa1, d5hxfa2
  • Heterogens: AG7, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hxfA (A:)
    mgpsldfalsllrrnirqvqtdqghftmlgvrdrlavlprhsqpgktiwvehklvnvlda
    velvdeqgvdleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdv
    vqygflnlsgkpthrtmmynfptkagqcggvvtsvgkvvgihiggngrqgfcaglkrsyf
    aseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hxfA (A:)
    mgpsldfalsllrrnirqvqtdqghftmlgvrdrlavlprhsqpgktiwvehklvnvlda
    velvdeqgvdleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdv
    vqygflnlsgkpthrtmmynfptkagqcggvvtsvgkvvgihiggngrqgfcaglkrsyf
    as