PDB entry 5hx8

View 5hx8 on RCSB PDB site
Description: Jak1 complex with 4-[(4-aminocyclohexyl)amino]-3-(1H-benzimidazol-2-yl)-1H-pyridin-2-one
Class: transferase/transferase inhibitor
Keywords: Kinase, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-01-29, released 2016-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK1
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK1, JAK1A, JAK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hx8a_
  • Chain 'B':
    Compound: Tyrosine-protein kinase JAK1
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK1, JAK1A, JAK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hx8b_
  • Heterogens: 66P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hx8A (A:)
    gdivsekkpatevdpthfekrflkrirdlgeghfgkvelcrydpegdntgeqvavkslkp
    esggnhiadlkkeieilrnlyhenivkykgictedggngiklimeflpsgslkeylpknk
    nkinlkqqlkyavqickgmdylgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdk
    eyytvkddrdspvfwyapeclmqskfyiasdvwsfgvtlhelltycdsdsspmalflkmi
    gpthgqmtvtrlvntlkegkrlpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeal
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hx8A (A:)
    ivsekkpatevdpthfekrflkrirdlgeghfgkvelcrydpegdntgeqvavkslkpnh
    iadlkkeieilrnlyhenivkykgictengiklimeflpsgslkeylpknknkinlkqql
    kyavqickgmdylgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdkeyytvkddr
    dspvfwyapeclmqskfyiasdvwsfgvtlhelltycdsdsspmalflkmigpthgqmtv
    trlvntlkegkrlpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeallk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hx8B (B:)
    gdivsekkpatevdpthfekrflkrirdlgeghfgkvelcrydpegdntgeqvavkslkp
    esggnhiadlkkeieilrnlyhenivkykgictedggngiklimeflpsgslkeylpknk
    nkinlkqqlkyavqickgmdylgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdk
    eyytvkddrdspvfwyapeclmqskfyiasdvwsfgvtlhelltycdsdsspmalflkmi
    gpthgqmtvtrlvntlkegkrlpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeal
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hx8B (B:)
    vdpthfekrflkrirdlgeghgkvelcrydpegdntgeqvavkslkpnhiadlkkeieil
    rnlyhenivkykgictngiklimeflpsgslkeylpknknkinlkqqlkyavqickgmdy
    lgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdkeyytvkddrdspvfwyapecl
    mqskfyiasdvwsfgvtlhelltycdsdsspmalflkmigpthgqmtvtrlvntlkegkr
    lpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeallk