PDB entry 5hx5

View 5hx5 on RCSB PDB site
Description: APOBEC3F Catalytic Domain Crystal Structure
Class: hydrolase
Keywords: apobec3f, hydrolase
Deposited on 2016-01-29, released 2016-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA dC->dU-editing enzyme APOBEC-3F
    Species: Homo sapiens [TaxId:9606]
    Gene: APOBEC3F
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IUX4 (Start-198)
      • engineered mutation (21)
      • engineered mutation (73)
      • engineered mutation (84)
      • engineered mutation (127)
      • engineered mutation (135)
      • engineered mutation (180)
      • engineered mutation (183)
      • engineered mutation (188)
    Domains in SCOPe 2.07: d5hx5a_
  • Chain 'B':
    Compound: DNA dC->dU-editing enzyme APOBEC-3F
    Species: Homo sapiens [TaxId:9606]
    Gene: APOBEC3F
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IUX4 (Start-198)
      • engineered mutation (21)
      • engineered mutation (73)
      • engineered mutation (84)
      • engineered mutation (127)
      • engineered mutation (135)
      • engineered mutation (180)
      • engineered mutation (183)
      • engineered mutation (188)
    Domains in SCOPe 2.07: d5hx5b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hx5A (A:)
    gplgspgipgkeilrnpmeamdphifyfhfknlrkaygrneswlcftmevvkhhspvswk
    rgvfrnqvdpetgrhaercflswfaddilspntnyevtwytswspcpecagevaeflarh
    snvnltiktarlyyfddtdyqeglrslsqegasveimgykdfkycwenfvynddepfkpw
    dgldynfldldsklqeile
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hx5A (A:)
    npmeamdphifyfhfknlrkaygrneswlcftmevvkhvswkrgvfrnrhaercflswfa
    ddilspntnyevtwytswspcpecagevaeflarhsnvnltiktarlyyfddtdyqeglr
    slsqegasveimgykdfkycwenfvynddepfkpwdgldynfldldsklqeile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hx5B (B:)
    gplgspgipgkeilrnpmeamdphifyfhfknlrkaygrneswlcftmevvkhhspvswk
    rgvfrnqvdpetgrhaercflswfaddilspntnyevtwytswspcpecagevaeflarh
    snvnltiktarlyyfddtdyqeglrslsqegasveimgykdfkycwenfvynddepfkpw
    dgldynfldldsklqeile
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hx5B (B:)
    npmeamdphifyfhfknswlcftmevvkhhspvswkrgvfrnrhaercflswfaddilsp
    ntnyevtwytswspcpecagevaeflarhsnvnltiktarlyyfddtdyqeglrslsqeg
    asveimgykdfkycwenfvynddepfkpwdgldynfldldsklqeile