PDB entry 5hww

View 5hww on RCSB PDB site
Description: crystal structure of pas1 complexed with 1,2,4-tmb
Deposited on 2016-01-29, released 2016-03-02
The last revision was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor histidine kinase TodS
    Species: Pseudomonas putida (strain F1 / ATCC 700007) [TaxId:351746]
    Gene: todS, Pput_2872
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5W4E3 (4-End)
      • expression tag (0-3)
  • Chain 'B':
    Compound: Sensor histidine kinase TodS
    Species: Pseudomonas putida (strain F1 / ATCC 700007) [TaxId:351746]
    Gene: todS, Pput_2872
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5W4E3 (4-End)
      • expression tag (2-3)
  • Heterogens: XBZ, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hwwA (A:)
    gamalyefvglldahgnvlevnqvalegggitleeirgkpfwkarwwqiskkteatqkrl
    vetassgefvrcdveilgksggreviavdfsllpicneegsivyllaegrnitdkkkaea
    mlalknqele
    

    Sequence, based on observed residues (ATOM records):
    >5hwwA (A:)
    gamalyefvglldahgnvlevnqvalegggitleeirgkpfwkarwwqiskkteatqkrl
    vetassgefvrcdveilgksggreviavdfsllpicneegsivyllaegrnitdkkkaea
    mlalknqe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hwwB (B:)
    gamalyefvglldahgnvlevnqvalegggitleeirgkpfwkarwwqiskkteatqkrl
    vetassgefvrcdveilgksggreviavdfsllpicneegsivyllaegrnitdkkkaea
    mlalknqele
    

    Sequence, based on observed residues (ATOM records):
    >5hwwB (B:)
    malyefvglldahgnvlevnqvalegggitleeirgkpfwkarwwqiskkteatqkrlve
    tassgefvrcdveilgksggreviavdfsllpicneegsivyllaegrnitdkk