PDB entry 5hwp

View 5hwp on RCSB PDB site
Description: mvas with acetylated cys115 in complex with coenzyme a
Deposited on 2016-01-29, released 2016-05-11
The last revision was dated 2016-07-13, with a file datestamp of 2016-07-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydroxymethylglutaryl-CoA synthase
    Species: Myxococcus xanthus (strain DK 1622) [TaxId:246197]
    Gene: mvaS, MXAN_4267
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, COA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hwpA (A:)
    ghmkkrvgiealavavpsryvdiedlarargvdpakytaglgaremavtdpgedtvalaa
    taaarlirqqdvdpsrigmlvvgtetgidhskpvashvqgllklprtmrtydtqhacygg
    taglmaavewiasgagagkvavvvcsdiaryglntageptqgggavallvseqpdllamd
    vglngvcsmdvydfwrpvgrrealvdghysitcylealsgayrgwrekalaaglvrwsda
    lpgeqlariayhvpfckmarkahtqlrlcdledaadaaastpesreaqaksaasydaqva
    tslglnsrignvytaslylalagllqheagalagqrigllsygsgcaaefysgtvgekaa
    ermakadleavlarrervsieeyerlmklpadapeavapspgafrlteirdhrrqyaeg
    

    Sequence, based on observed residues (ATOM records):
    >5hwpA (A:)
    krvgiealavavpsryvdiedlarargvdpakytaglgaremavtdpgedtvalaataaa
    rlirqqdvdpsrigmlvvgtetgidhskpvashvqgllklprtmrtydtqhacyggtagl
    maavewiasgagagkvavvvcsdiaryglntageptqgggavallvseqpdllamdvgln
    gvcsmdvydfwrpvgrrealvdghysitcylealsgayrgwrekalaaglvrwsdalpge
    qlariayhvpfckmarkahtqlrlcdledaadaaastpesreaqaksaasydaqvatslg
    lnsrignvytaslylalagllqheagalagqrigllsygsgcaaefysgtvgekaaerma
    kadleavlarrervsieeyerlmklpadapeavapspgafrlteirdhrrqyaeg