PDB entry 5hwj

View 5hwj on RCSB PDB site
Description: Crystal structure of keto-deoxy-D-galactarate dehydratase
Class: lyase
Keywords: decarboxylating, dehydratase, TIM-barrel, lyase
Deposited on 2016-01-29, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable 5-dehydro-4-deoxyglucarate dehydratase
    Species: Agrobacterium fabrum (strain C58 / ATCC 33970) [TaxId:176299]
    Gene: Atu3140, AGR_L_3338
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UB77 (0-302)
      • conflict (1)
      • expression tag (303-309)
    Domains in SCOPe 2.07: d5hwja1, d5hwja2
  • Chain 'B':
    Compound: Probable 5-dehydro-4-deoxyglucarate dehydratase
    Species: Agrobacterium fabrum (strain C58 / ATCC 33970) [TaxId:176299]
    Gene: Atu3140, AGR_L_3338
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UB77 (0-302)
      • conflict (1)
    Domains in SCOPe 2.07: d5hwjb_
  • Chain 'C':
    Compound: Probable 5-dehydro-4-deoxyglucarate dehydratase
    Species: Agrobacterium fabrum (strain C58 / ATCC 33970) [TaxId:176299]
    Gene: Atu3140, AGR_L_3338
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UB77 (0-End)
      • conflict (1)
    Domains in SCOPe 2.07: d5hwjc_
  • Chain 'D':
    Compound: Probable 5-dehydro-4-deoxyglucarate dehydratase
    Species: Agrobacterium fabrum (strain C58 / ATCC 33970) [TaxId:176299]
    Gene: Atu3140, AGR_L_3338
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UB77 (0-302)
      • conflict (1)
      • expression tag (303-304)
    Domains in SCOPe 2.07: d5hwjd1, d5hwjd2
  • Heterogens: GOL, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hwjA (A:)
    mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
    kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
    glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
    kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
    lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
    rkawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hwjA (A:)
    mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
    kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
    glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
    kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
    lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
    rkawshpqfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hwjB (B:)
    mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
    kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
    glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
    kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
    lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
    rkawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hwjB (B:)
    mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
    kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
    glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
    kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
    lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
    rka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hwjC (C:)
    mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
    kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
    glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
    kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
    lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
    rkawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hwjC (C:)
    mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
    kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
    glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
    kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
    lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
    r
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hwjD (D:)
    mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
    kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
    glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
    kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
    lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
    rkawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hwjD (D:)
    mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
    kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
    glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
    kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
    lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
    rkaws