PDB entry 5hwg

View 5hwg on RCSB PDB site
Description: Structure of a cysteine hydrolase with a negative substrate
Class: hydrolase
Keywords: hydrolase, catalyic triad
Deposited on 2016-01-29, released 2017-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isochorismatase
    Species: Microbacterium hydrocarbonoxydans [TaxId:273678]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0K0XHU0 (Start-186)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5hwga_
  • Heterogens: 66Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hwgA (A:)
    mgshhhhhhmaaprrtvvlaidlqagvtpgcfdeegvlsraaalveraraggvpvvwvhh
    dpvgvgtpewelaaplhraegeplvrknyrdsfadttlretldelgathlvitgaqsdfa
    vrttmqraaaegydvtlvsdahttvdtewegvrisgeqivahtnmyfsglrypgqefvia
    thdhval
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hwgA (A:)
    prrtvvlaidlqagvtpgcfdeegvlsraaalveraraggvpvvwvhhdpvgvgtpewel
    aaplhraegeplvrknyrdsfadttlretldelgathlvitgaqsdfavrttmqraaaeg
    ydvtlvsdahttvdtewegvrisgeqivahtnmyfsglrypgqefviathdhval