PDB entry 5hwa

View 5hwa on RCSB PDB site
Description: Crystal Structure of MH-K1 chitosanase in substrate-bound form
Class: hydrolase
Keywords: chitosanase, GH-46, hydrolase, substrate-bound form
Deposited on 2016-01-29, released 2017-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitosanase
    Species: Bacillus circulans [TaxId:1397]
    Gene: CSN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33673 (0-258)
      • engineered mutation (36)
    Domains in SCOPe 2.07: d5hwaa_
  • Heterogens: GCS, CAC, ACY, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hwaA (A:)
    aspddnfspetlqflrnntgldgeqwnnimklinkpqqddlnwikyygycediedergyt
    iglfgattggsrdthpdgpdlfkaydaakgasnpsadgalkrlgingkmkgsileikdse
    kvfcgkikklqndaawrkamwetfynvyirysveqarqrgftsavtigsfvdtalnqgat
    ggsdtlqgllarsgsssnektfmknfhakrtlvvdtnkynkppngknrvkqwdtlvdmgk
    mnlknvdseiaqvtdwemk