PDB entry 5hw4

View 5hw4 on RCSB PDB site
Description: crystal structure of escherichia coli 16s rrna methyltransferase rsmi in complex with adomet
Deposited on 2016-01-28, released 2016-10-19
The last revision was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal RNA small subunit methyltransferase I
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: rsmI, yraL, b3146, JW3115
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67087 (1-End)
      • expression tag (0)
  • Chain 'B':
    Compound: Ribosomal RNA small subunit methyltransferase I
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: rsmI, yraL, b3146, JW3115
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67087 (1-End)
      • expression tag (0)
  • Chain 'C':
    Compound: Ribosomal RNA small subunit methyltransferase I
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: rsmI, yraL, b3146, JW3115
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67087 (1-End)
      • expression tag (0)
  • Heterogens: SAM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hw4A (A:)
    mgqlyivptpignladitqralevlqavdliaaedtrhtglllqhfginarlfalhdhne
    qqkaetllaklqegqnialvsdagtplindpgyhlvrtcreagirvvplpgpcaaitals
    aaglpsdrfcyegflpakskgrrdalkaieaeprtlifyesthrlldsledivavlgesr
    yvvlareltktwetihgapvgellawvkedenrrkgemvliveghkaqeedlpadalrtl
    allqaelp
    

    Sequence, based on observed residues (ATOM records):
    >5hw4A (A:)
    mgqlyivptpignladitqralevlqavdliaaedtrhtglllqhfginarlfalheqqk
    aetllaklqegqnialvsdagtplindpgyhlvrtcreagirvvplpgpcaaitalsaag
    lpsdrfcyegflpakskgrrdalkaieaeprtlifyesthrlldsledivavlgesryvv
    lareltktwetihgapvgellawvkedenrrkgemvliveghkaqeed
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hw4B (B:)
    mgqlyivptpignladitqralevlqavdliaaedtrhtglllqhfginarlfalhdhne
    qqkaetllaklqegqnialvsdagtplindpgyhlvrtcreagirvvplpgpcaaitals
    aaglpsdrfcyegflpakskgrrdalkaieaeprtlifyesthrlldsledivavlgesr
    yvvlareltktwetihgapvgellawvkedenrrkgemvliveghkaqeedlpadalrtl
    allqaelp
    

    Sequence, based on observed residues (ATOM records):
    >5hw4B (B:)
    mgqlyivptpignladitqralevlqavdliaaedtrhtglllqhfginarlfalhqkae
    tllaklqegqnialvsdagtplindpgyhlvrtcreagirvvplpgpcaaitalsaaglp
    sdrfcyegflpakskgrrdalkaieaeprtlifyesthrlldsledivavlgesryvvla
    reltktwetihgapvgellawvkedenrrkgemvliveghka
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hw4C (C:)
    mgqlyivptpignladitqralevlqavdliaaedtrhtglllqhfginarlfalhdhne
    qqkaetllaklqegqnialvsdagtplindpgyhlvrtcreagirvvplpgpcaaitals
    aaglpsdrfcyegflpakskgrrdalkaieaeprtlifyesthrlldsledivavlgesr
    yvvlareltktwetihgapvgellawvkedenrrkgemvliveghkaqeedlpadalrtl
    allqaelp
    

    Sequence, based on observed residues (ATOM records):
    >5hw4C (C:)
    mgqlyivptpignladitqralevlqavdliaaedtrhtglllqhfginarlfalhqqka
    etllaklqegqnialvsdagtplindpgyhlvrtcreagirvvplpgpcaaitalsaagl
    psdrfcyegflpakskgrrdalkaieaeprtlifyesthrlldsledivavlgesryvvl
    areltktwetihgapvgellawvkedenrrkgemvliveghk