PDB entry 5hw0

View 5hw0 on RCSB PDB site
Description: Erwinia chrysanthemi L-asparaginase + Glutamic acid
Class: hydrolase
Keywords: L-asparaginase, Erwinia chrysanthemum, Glutamic acid, HYDROLASE
Deposited on 2016-01-28, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-asparaginase
    Species: Dickeya chrysanthemi [TaxId:556]
    Gene: ansB, asn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hw0a_
  • Chain 'B':
    Compound: L-asparaginase
    Species: Dickeya chrysanthemi [TaxId:556]
    Gene: ansB, asn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hw0b_
  • Chain 'C':
    Compound: L-asparaginase
    Species: Dickeya chrysanthemi [TaxId:556]
    Gene: ansB, asn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hw0c_
  • Chain 'D':
    Compound: L-asparaginase
    Species: Dickeya chrysanthemi [TaxId:556]
    Gene: ansB, asn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hw0d_
  • Heterogens: GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hw0A (A:)
    hmdklpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsn
    masenmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfva
    amrpataisadgpmnlleavrvagdkqsrgrgvmvvlndrigsaryitktnastldtfka
    neegylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiq
    hgvkgivyagmgagsvsvrgiagmrkamekgvvvirstrtgngivppdeelpglvsdsln
    paharillmlaltrtsdpkviqeyfhty
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hw0A (A:)
    klpnivilatggtiagalgvdtlinavpevkklanvkgeqfsnmasenmtgdvvlklsqr
    vnellarddvdgvvithgtdtveesayflhltvksdkpvvfvaamrpataisadgpmnll
    eavrvagdkqsrgrgvmvvlndrigsaryitktnastldtfkaneegylgviignriyyq
    nridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqhgvkgivyagmgagsvs
    vrgiagmrkamekgvvvirstrtgngivppdeelpglvsdslnpaharillmlaltrtsd
    pkviqeyfhty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hw0B (B:)
    hmdklpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsn
    masenmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfva
    amrpataisadgpmnlleavrvagdkqsrgrgvmvvlndrigsaryitktnastldtfka
    neegylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiq
    hgvkgivyagmgagsvsvrgiagmrkamekgvvvirstrtgngivppdeelpglvsdsln
    paharillmlaltrtsdpkviqeyfhty
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hw0B (B:)
    klpnivilatggtiagvdtlinavpevkklanvkgeqfsnmasenmtgdvvlklsqrvne
    llarddvdgvvithgtdtveesayflhltvksdkpvvfvaamrpataisadgpmnlleav
    rvagdkqsrgrgvmvvlndrigsaryitktnastldtfkaneegylgviignriyyqnri
    dklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqhgvkgivyagmgagsvsvrg
    iagmrkamekgvvvirstrtgngivppdeelpglvsdslnpaharillmlaltrtsdpkv
    iqeyfhty
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hw0C (C:)
    hmdklpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsn
    masenmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfva
    amrpataisadgpmnlleavrvagdkqsrgrgvmvvlndrigsaryitktnastldtfka
    neegylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiq
    hgvkgivyagmgagsvsvrgiagmrkamekgvvvirstrtgngivppdeelpglvsdsln
    paharillmlaltrtsdpkviqeyfhty
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hw0C (C:)
    klpnivilatggtiagalgvdtlinavpevkklanvkgeqfsnmasenmtgdvvlklsqr
    vnellarddvdgvvithgtdtveesayflhltvksdkpvvfvaamrpataisadgpmnll
    eavrvagdkqsrgrgvmvvlndrigsaryitktnastldtfkaneegylgviignriyyq
    nridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqhgvkgivyagmgagsvs
    vrgiagmrkamekgvvvirstrtgngivppdeelpglvsdslnpaharillmlaltrtsd
    pkviqeyfhty
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hw0D (D:)
    hmdklpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsn
    masenmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfva
    amrpataisadgpmnlleavrvagdkqsrgrgvmvvlndrigsaryitktnastldtfka
    neegylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiq
    hgvkgivyagmgagsvsvrgiagmrkamekgvvvirstrtgngivppdeelpglvsdsln
    paharillmlaltrtsdpkviqeyfhty
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hw0D (D:)
    klpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsnmas
    enmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfvaamr
    pataisadgpmnlleavrvagdkqsrgrgvmvvlndrigsaryitktnastldtfkanee
    gylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqhgv
    kgivyagmgagsvsvrgiagmrkamekgvvvirstrtgngivppdeelpglvsdslnpah
    arillmlaltrtsdpkviqeyfhty