PDB entry 5hvv

View 5hvv on RCSB PDB site
Description: Crystal structure of Pro1 deletion and M2A double mutant of Macrophage Migration Inhibitory Factor
Class: isomerase
Keywords: Isomerase, surface, mutation
Deposited on 2016-01-28, released 2016-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-112)
      • engineered mutation (0)
    Domains in SCOPe 2.08: d5hvva_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-112)
      • engineered mutation (0)
    Domains in SCOPe 2.08: d5hvvb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-112)
      • engineered mutation (0)
    Domains in SCOPe 2.08: d5hvvc_
  • Heterogens: SO4, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hvvA (A:)
    afivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcsl
    hsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hvvB (B:)
    afivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcsl
    hsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hvvC (C:)
    afivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcsl
    hsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa