PDB entry 5hvt

View 5hvt on RCSB PDB site
Description: Crystal Structure of Macrophage Migration Inhibitory Factor (MIF) with a Potent Inhibitor (NVS-2)
Class: ISOMERASE/ISOMERASE inhibitor
Keywords: Cytokine, Inhibitor, Complex, ISOMERASE-ISOMERASE inhibitor complex
Deposited on 2016-01-28, released 2016-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hvta_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hvtb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hvtc_
  • Heterogens: SO4, NVS, GOL, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hvtA (A:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hvtB (B:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hvtC (C:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa