PDB entry 5hvm

View 5hvm on RCSB PDB site
Description: Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A
Class: transferase
Keywords: trehalose-6-phosphate synthase, TRANSFERASE
Deposited on 2016-01-28, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
    Species: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) [TaxId:330879]
    Gene: AFUA_6G12950
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hvma_
  • Chain 'B':
    Compound: Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
    Species: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) [TaxId:330879]
    Gene: AFUA_6G12950
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hvmb_
  • Heterogens: UDP, VDM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hvmA (A:)
    mpslenstqnearlllvsnrlpitikrsedgkydfsmssgglvsglsglsksttfqwygw
    pglevpeeeipvvkqrlkdeygaipvfiddeladrhyngfsnsilwplfhyhpgeitfde
    saweaykeanrlfakavakevqdgdliwvhdyhlmllpemlreeigdskenvkigfflht
    pfpsseiyrilpvrnelllgvlhcdligfhtydytrhflsacsrllglattpngiefqgk
    viacgafpigidpekfqeglkkekvqkriaqleqkfqgvklmvgvdrldyikgvpqklha
    levflsdhpewvgkvvlvqvavpsrqdveeyqnlravvnelvgringkfgtvefmpihfl
    hksvnfdelialyavsdacivsstrdgmnlvayeyiasqqkrhgvlvlsefagaaqslng
    siiinpwnteelagayqeavtmsdeqralnfskldkyvnkytsafwgqsfvtelnrisah
    sagkfqsrkaklpesadaekpmngsgeseesqttq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hvmA (A:)
    arlllvsnrlpiydfsmsgglvsgfqwygwpglevpepvvkqrlkdeygaipvfiddela
    drhyngfsnsilwplfhyhpgeitfdesaweaykeanrlfakavakevqdgdliwvhdyh
    lmllpemlreeigdskenvkigfflhtpfpsseiyrilpvrnelllgvlhcdligfhtyd
    ytrhflsacsrllglattpngiefqgkviacgafpigidpekfqeglkkekvqkriaqle
    qkfqgvklmvgvdrldyikgvpqklhalevflsdhpewvgkvvlvqvavpsrqdveeyqn
    lravvnelvgringkfgtvefmpihflhksvnfdelialyavsdacivsstrdgmnlvay
    eyiasqqkrhgvlvlsefagaaqslngsiiinpwnteelagayqeavtmsdeqralnfsk
    ldkyvnkytsafwgqsfvtelnrisa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hvmB (B:)
    mpslenstqnearlllvsnrlpitikrsedgkydfsmssgglvsglsglsksttfqwygw
    pglevpeeeipvvkqrlkdeygaipvfiddeladrhyngfsnsilwplfhyhpgeitfde
    saweaykeanrlfakavakevqdgdliwvhdyhlmllpemlreeigdskenvkigfflht
    pfpsseiyrilpvrnelllgvlhcdligfhtydytrhflsacsrllglattpngiefqgk
    viacgafpigidpekfqeglkkekvqkriaqleqkfqgvklmvgvdrldyikgvpqklha
    levflsdhpewvgkvvlvqvavpsrqdveeyqnlravvnelvgringkfgtvefmpihfl
    hksvnfdelialyavsdacivsstrdgmnlvayeyiasqqkrhgvlvlsefagaaqslng
    siiinpwnteelagayqeavtmsdeqralnfskldkyvnkytsafwgqsfvtelnrisah
    sagkfqsrkaklpesadaekpmngsgeseesqttq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hvmB (B:)
    arlllvsnrlpitikrsedgkydgglvsgtfqwygwpglevpepvvkqrlkdeygaipvf
    iddeladrhyngfsnsilwplfhyhpgeitfdesaweaykeanrlfakavakevqdgdli
    wvhdyhlmllpemlreeigdskenvkigfflhtpfpsseiyrilpvrnelllgvlhcdli
    gfhtydytrhflsacsrllglattpngiefqgkviacgafpigidpekfqeglkkekvqk
    riaqleqkfqgvklmvgvdrldyikgvpqklhalevflsdhpewvgkvvlvqvavpsrqd
    veeyqnlravvnelvgringkfgtvefmpihflhksvnfdelialyavsdacivsstrdg
    mnlvayeyiasqqkrhgvlvlsefagaaqslngsiiinpwnteelagayqeavtmsdeqr
    alnfskldkyvnkytsafwgqsfvtelnrisa