PDB entry 5hvl

View 5hvl on RCSB PDB site
Description: Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A
Class: transferase
Keywords: trehalose-6-phosphate synthase, TRANSFERASE
Deposited on 2016-01-28, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha,alpha-trehalose-phosphate synthase [UDP-forming]
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: TPS1, CaO19.13961, CaO19.6640
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hvla_
  • Chain 'B':
    Compound: Alpha,alpha-trehalose-phosphate synthase [UDP-forming]
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: TPS1, CaO19.13961, CaO19.6640
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hvlb_
  • Heterogens: UDP, VDM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hvlA (A:)
    mvqgkvlvvsnripvtikrldngsydysmssgglvtalqglkkttefqwygwpgleiped
    eqtkvndelkskfnctaiflsdtiadlhyngfsnsilwplfhyhpgemnfdenawaayie
    ankkfaleivkqvndddmiwvhdyhlmllpemlrqeignkkknikigfflhtpfpsseiy
    rilpvrkeilegvlscdligfhtydyarhfissvsrivpnvstlpngikyqgrsisigaf
    pigidvdnfidglkkdsvverikqlkskfkdvkvivgvdrldyikgvpqklhafevflne
    npewigkvvlvqvavpsrgdveeyqslrstvselvgringefgtvefvpihylhksipfd
    elislynisdvclvsstrdgmnlvsyeyiacqqdrkgvlilsefagaaqslngalivnpw
    ntedlseaikesltlpeekrefnfkklftyiskytsgfwgesfvkelykcnpqkslrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hvlA (A:)
    gkvlvvsnripvtikrldngsydysmssgglvtalqglkkttefqwygwpgleipedeqt
    kvndelkskfnctaiflsdtiadlhyngfsnsilwplfhyhpgemnfdenawaayieank
    kfaleivkqvndddmiwvhdyhlmllpemlrqeignkkknikigfflhtpfpsseiyril
    pvrkeilegvlscdligfhtydyarhfissvsrivpnvstlpngikyqgrsisigafpig
    idvdnfidglkkdsvverikqlkskfkdvkvivgvdrldyikgvpqklhafevflnenpe
    wigkvvlvqvavpsrgdveeyqslrstvselvgringefgtvefvpihylhksipfdeli
    slynisdvclvsstrdgmnlvsyeyiacqqdrkgvlilsefagaaqslngalivnpwnte
    dlseaikesltlpeekrefnfkklftyiskytsgfwgesfvkelykc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hvlB (B:)
    mvqgkvlvvsnripvtikrldngsydysmssgglvtalqglkkttefqwygwpgleiped
    eqtkvndelkskfnctaiflsdtiadlhyngfsnsilwplfhyhpgemnfdenawaayie
    ankkfaleivkqvndddmiwvhdyhlmllpemlrqeignkkknikigfflhtpfpsseiy
    rilpvrkeilegvlscdligfhtydyarhfissvsrivpnvstlpngikyqgrsisigaf
    pigidvdnfidglkkdsvverikqlkskfkdvkvivgvdrldyikgvpqklhafevflne
    npewigkvvlvqvavpsrgdveeyqslrstvselvgringefgtvefvpihylhksipfd
    elislynisdvclvsstrdgmnlvsyeyiacqqdrkgvlilsefagaaqslngalivnpw
    ntedlseaikesltlpeekrefnfkklftyiskytsgfwgesfvkelykcnpqkslrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hvlB (B:)
    gkvlvvsnripvtikrldngsydysmssgglvtalqglkkttefqwygwpgleipedeqt
    kvndelkskfnctaiflsdtiadlhyngfsnsilwplfhyhpgemnfdenawaayieank
    kfaleivkqvndddmiwvhdyhlmllpemlrqeignkkknikigfflhtpfpsseiyril
    pvrkeilegvlscdligfhtydyarhfissvsrivpnvstlpngikyqgrsisigafpig
    idvdnfidglkkdsvverikqlkskfkdvkvivgvdrldyikgvpqklhafevflnenpe
    wigkvvlvqvavpsrgdveeyqslrstvselvgringefgtvefvpihylhksipfdeli
    slynisdvclvsstrdgmnlvsyeyiacqqdrkgvlilsefagaaqslngalivnpwnte
    dlseaikesltlpeekrefnfkklftyiskytsgfwgesfvkelyk