PDB entry 5hvc

View 5hvc on RCSB PDB site
Description: solution structure of the apo state of the acyl carrier protein from the mlsa2 subunit of the mycolactone polyketide synthase
Deposited on 2016-01-28, released 2016-03-09
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type I modular polyketide synthase
    Species: Mycobacterium ulcerans [TaxId:1809]
    Gene: mlsA2, MUP039c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6MZA5 (4-94)
      • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5hvcA (A:)
    gshmrlnglspqqqqqtlatlvaaatatvlghhtpesispatafkdlgidsltalelrnt
    lthntgldlpptlifdhptphaltqhlhtrltqsh