PDB entry 5huz

View 5huz on RCSB PDB site
Description: solution structure of coiled coil domain of myosin binding subunit of myosin light chain phosphatase
Deposited on 2016-01-27, released 2016-03-02
The last revision was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein phosphatase 1 regulatory subunit 12A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1R12A, MBS, MYPT1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein phosphatase 1 regulatory subunit 12A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1R12A, MBS, MYPT1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5huzA (A:)
    dfkklyeqilaeneklkaqlhdtnmeltdlklqlekatqrqerfadrs
    

    Sequence, based on observed residues (ATOM records):
    >5huzA (A:)
    dfkklyeqilaeneklkaqlhdtnmeltdlklqlekatqrqerf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5huzB (B:)
    dfkklyeqilaeneklkaqlhdtnmeltdlklqlekatqrqerfadrs
    

    Sequence, based on observed residues (ATOM records):
    >5huzB (B:)
    dfkklyeqilaeneklkaqlhdtnmeltdlklqlekatqrqerf