PDB entry 5huy

View 5huy on RCSB PDB site
Description: structure of hcmv small terminase nls bound to importin alpha
Deposited on 2016-01-28, released 2016-03-16
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HCMV small terminase
    Species: Human herpesvirus 5 strain Toledo [TaxId:311339]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HUY
  • Chain 'B':
    Compound: HCMV small terminase
    Species: Human herpesvirus 5 strain Toledo [TaxId:311339]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HUY
  • Chain 'C':
    Compound: Importin subunit alpha-1
    Species: Mus musculus [TaxId:10090]
    Gene: Kpna2, Rch1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5huyA (A:)
    vsrrvratrkrprras
    

    Sequence, based on observed residues (ATOM records):
    >5huyA (A:)
    atrkrprra
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5huyB (B:)
    vsrrvratrkrprras
    

    Sequence, based on observed residues (ATOM records):
    >5huyB (B:)
    atrkrpr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5huyC (C:)
    stnenanlpaarlnrfknkgkdstemrrrrievnvelrkakkdeqmlkrrnvssfpddat
    splqenrnnqgtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiragli
    pkfvsflgktdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseq
    avwalgniagdgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnkn
    pappldaveqilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkl
    lgatelpivtpalraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsn
    itagrqdqiqqvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgi
    ieplmnllsakdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhen
    esvykaslnliekyfsveeeedqnvvpettsegfafqvqdgapgtfnf
    

    Sequence, based on observed residues (ATOM records):
    >5huyC (C:)
    nwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdcs
    piqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgs
    afrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqilp
    tlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpal
    raignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvv
    nhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakdt
    kiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnliek
    yfs