PDB entry 5huv

View 5huv on RCSB PDB site
Description: Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose
Class: transferase
Keywords: trehalose-6-phosphate synthase, TRANSFERASE
Deposited on 2016-01-27, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha,alpha-trehalose-phosphate synthase [UDP-forming]
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: TPS1, CaO19.13961, CaO19.6640
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92410
      • engineered mutation (340)
      • engineered mutation (345)
    Domains in SCOPe 2.07: d5huva_
  • Chain 'B':
    Compound: Alpha,alpha-trehalose-phosphate synthase [UDP-forming]
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: TPS1, CaO19.13961, CaO19.6640
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92410
      • engineered mutation (340)
      • engineered mutation (345)
    Domains in SCOPe 2.07: d5huvb_
  • Heterogens: UPG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5huvA (A:)
    mvqgkvlvvsnripvtikrldngsydysmssgglvtalqglkkttefqwygwpgleiped
    eqtkvndelkskfnctaiflsdtiadlhyngfsnsilwplfhyhpgemnfdenawaayie
    ankkfaleivkqvndddmiwvhdyhlmllpemlrqeignkkknikigfflhtpfpsseiy
    rilpvrkeilegvlscdligfhtydyarhfissvsrivpnvstlpngikyqgrsisigaf
    pigidvdnfidglkkdsvverikqlkskfkdvkvivgvdrldyikgvpqklhafevflne
    npewigkvvlvqvavpsrgdveeyqslrstvselvgringrfgtvrfvpihylhksipfd
    elislynisdvclvsstrdgmnlvsyeyiacqqdrkgvlilsefagaaqslngalivnpw
    ntedlseaikesltlpeekrefnfkklftyiskytsgfwgesfvkelykcnpqkslrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5huvA (A:)
    gkvlvvsnripvtikrldngsydysmssgglvtalqglkkttefqwygwpgleipedeqt
    kvndelkskfnctaiflsdtiadlhyngfsnsilwplfhyhpgemnfdenawaayieank
    kfaleivkqvndddmiwvhdyhlmllpemlrqeignkkknikigfflhtpfpsseiyril
    pvrkeilegvlscdligfhtydyarhfissvsrivpnvstlpngikyqgrsisigafpig
    idvdnfidglkkdsvverikqlkskfkdvkvivgvdrldyikgvpqklhafevflnenpe
    wigkvvlvqvavpsrgdveeyqslrstvselvgringrfgtvrfvpihylhksipfdeli
    slynisdvclvsstrdgmnlvsyeyiacqqdrkgvlilsefagaaqslngalivnpwnte
    dlseaikesltlpeekrefnfkklftyiskytsgfwgesfvkelykcnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5huvB (B:)
    mvqgkvlvvsnripvtikrldngsydysmssgglvtalqglkkttefqwygwpgleiped
    eqtkvndelkskfnctaiflsdtiadlhyngfsnsilwplfhyhpgemnfdenawaayie
    ankkfaleivkqvndddmiwvhdyhlmllpemlrqeignkkknikigfflhtpfpsseiy
    rilpvrkeilegvlscdligfhtydyarhfissvsrivpnvstlpngikyqgrsisigaf
    pigidvdnfidglkkdsvverikqlkskfkdvkvivgvdrldyikgvpqklhafevflne
    npewigkvvlvqvavpsrgdveeyqslrstvselvgringrfgtvrfvpihylhksipfd
    elislynisdvclvsstrdgmnlvsyeyiacqqdrkgvlilsefagaaqslngalivnpw
    ntedlseaikesltlpeekrefnfkklftyiskytsgfwgesfvkelykcnpqkslrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5huvB (B:)
    gkvlvvsnripvtikrgsydysmsslvtalqglkkttefqwygwpgleipedeqtkvnde
    lkskfnctaiflsdtiadlhyngfsnsilwplfhyhpgemnfdenawaayieankkfale
    ivkqvndddmiwvhdyhlmllpemlrqeignkkknikigfflhtpfpsseiyrilpvrke
    ilegvlscdligfhtydyarhfissvsrivpnvstlpngikyqgrsisigafpigidvdn
    fidglkkdsvverikqlkskfkdvkvivgvdrldyikgvpqklhafevflnenpewigkv
    vlvqvavpsrgdveeyqslrstvselvgringrfgtvrfvpihylhksipfdelislyni
    sdvclvsstrdgmnlvsyeyiacqqdrkgvlilsefagaaqslngalivnpwntedlsea
    ikesltlpeekrefnfkklftyiskytsgfwgesfvkelykcnp