PDB entry 5hus

View 5hus on RCSB PDB site
Description: structure of candida albicans trehalose synthase regulatory protein c- terminal domain
Deposited on 2016-01-27, released 2017-05-03
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trehalose synthase regulatory protein
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: TPS3, CaO19.12808, CaO19.5348
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5husA (A:)
    gnlvpftknafkdwcsvngkrliilaleissavsnsrgnsagstsgkvnvidpsglvrll
    sdlvesqdtfvyllsylqrsdldimfkrypqigliaengnfvkligaknwisladkdeln
    swmpeivklveskverlpgsfcealdatvrfhagksfsedrersldtmgetiqhintlfe
    hngvhatlvrnsvivqkdqislkairlvlschnsnldqkyvvthinefqqpmkddipsnd
    hevaavlysggltsideanyeyvnslkkdigntltvtlisssneetktaatygvrginel
    lcilns
    

    Sequence, based on observed residues (ATOM records):
    >5husA (A:)
    gnlvpftknafkdwcsvngkrliilaleissavkvnvidpsglvrllsdlvesqdtfvyl
    lsylqrsdldimfkrypqigliaengnfvkligaknwisladkdelnswmpeivklvesk
    verlpgsfcealdatvrfhagksfsedrersldtmgetiqhintlfehngvhatlvrnsv
    ivqkdqislkairlvlschnsnldqkyvvthinefqqpmkddipsndhevaavlysgglt
    sideanyeyvnslkkdigntltvtlisssneetktaatygvrginellcilns