PDB entry 5hur

View 5hur on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS L25T/I92K at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, pdtp, Structural Genomics
Deposited on 2016-01-27, released 2016-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (24)
      • engineered mutation (43-44)
      • engineered mutation (85)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d5hura_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hurA (A:)
    atstkklhkepatlikaidgdtvktmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglaykyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hurA (A:)
    lhkepatlikaidgdtvktmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
    evefdkgqrtdkygrglaykyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
    kkeklniws