PDB entry 5huj

View 5huj on RCSB PDB site
Description: Crystal Structure of NadE from Streptococcus pyogenes
Class: transferase
Keywords: transferase
Deposited on 2016-01-27, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nh(3)-dependent nad(+) synthetase
    Species: Streptococcus pyogenes serotype M49 (strain NZ131) [TaxId:471876]
    Gene: nadE, Spy49_1281c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5huja_
  • Chain 'B':
    Compound: nh(3)-dependent nad(+) synthetase
    Species: Streptococcus pyogenes serotype M49 (strain NZ131) [TaxId:471876]
    Gene: nadE, Spy49_1281c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hujb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hujA (A:)
    mhhhhhhssgvdlgtenlyfqsgsgmlmervndmtlqeeiirqlgvkasidpqeeirktv
    dflkaylrkhsflktyvlgisggqdstlagklaqmaiaelreetsdqayqfiavrlpygv
    qadeadaqkalafiapdqtltinikaavdgqvealqaagveisdfnkgnikarqrmisqy
    aiagqmagavigtdhaaenitgfftkfgdggadilplfrlnkrqgkallkvlgadaalye
    kvptadledqkpgladevalgvtyqdiddylegkliskvaqatiekwwhkgqhkrhlpit
    ifadfwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hujA (A:)
    mtlqeeiirqlgvkasidpqeeirktvdflkaylrkhsflktyvlgisggqdstlagkla
    qmaiaelreetsdqayqfiavrlpygvqdeadaqkalafiapdqtltinikaavdgqvea
    lqaagveisdfnkgnikarqrmisqyaiagqmagavigtdhaaenitgfftkfgdggadi
    lplfrlnkrqgkallkvlgadaalyeladevalgvtyqdiddylegkliskvaqatiekw
    whkgqhkrhlpitifadfwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hujB (B:)
    mhhhhhhssgvdlgtenlyfqsgsgmlmervndmtlqeeiirqlgvkasidpqeeirktv
    dflkaylrkhsflktyvlgisggqdstlagklaqmaiaelreetsdqayqfiavrlpygv
    qadeadaqkalafiapdqtltinikaavdgqvealqaagveisdfnkgnikarqrmisqy
    aiagqmagavigtdhaaenitgfftkfgdggadilplfrlnkrqgkallkvlgadaalye
    kvptadledqkpgladevalgvtyqdiddylegkliskvaqatiekwwhkgqhkrhlpit
    ifadfwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hujB (B:)
    mtlqeeiirqlgvkasidpqeeirktvdflkaylrkhsflktyvlgisggqdstlagkla
    qmaiaelreetsdqayqfiavrlpygvqdeadaqkalafiapdqtltinikaavdgqvea
    lqaagveisdfnkgnikarqrmisqyaiagqmagavigtdhaaenitgfftkfgdggadi
    lplfrlnkrqgkallkvlgadaalyeladevalgvtyqdiddylegkliskvaqatiekw
    whkgqhkrhlpitifadfwk