PDB entry 5huf

View 5huf on RCSB PDB site
Description: The crystal structure of hemagglutinin from A/gyrfalcon/Washington/41088-6/2014 influenza virus
Class: viral protein
Keywords: hemagglutinin, influenza virus, H5Nx, VIRAL PROTEIN
Deposited on 2016-01-27, released 2016-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (A/gyrfalcon/Washington/41088-6/2014(H5N8)) [TaxId:1589663]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (A/gyrfalcon/Washington/41088-6/2014(H5N8)) [TaxId:1589663]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C4X0C0 (0-173)
      • expression tag (174-175)
  • Chain 'C':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (A/gyrfalcon/Washington/41088-6/2014(H5N8)) [TaxId:1589663]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (A/gyrfalcon/Washington/41088-6/2014(H5N8)) [TaxId:1589663]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C4X0C0 (0-173)
      • expression tag (174-175)
  • Chain 'E':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (A/gyrfalcon/Washington/41088-6/2014(H5N8)) [TaxId:1589663]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (A/gyrfalcon/Washington/41088-6/2014(H5N8)) [TaxId:1589663]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C4X0C0 (0-173)
      • expression tag (174-175)
  • Heterogens: NAG, MAN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hufA (A:)
    adlgsdqicigyhannstkqvdtimeknvtvthaqdilekthngklcdlngvkplilkdc
    svagwllgnpmcdefirvpewsyiveranpandlcypgtlndyeelkhllsrinhfektl
    iiprsswpnhetslgvsaacpyqgassffrnvvwlikkndayptikisynntnredllil
    wgihhsnnaaeqtnlyknpdtyvsvgtstlnqrlvpkiatrsqvngqsgrmdffwtilkp
    ndaihfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnih
    pltigecpkyvksnklvlatglrnsplrerrrkr
    

    Sequence, based on observed residues (ATOM records):
    >5hufA (A:)
    lgsdqicigyhannstkqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsv
    agwllgnpmcdefirvpewsyiveranpandlcypgtlndyeelkhllsrinhfektlii
    prsswpnhetslgvsaacpyqgassffrnvvwlikkndayptikisynntnredllilwg
    ihhsnnaaeqtnlyknpdtyvsvgtstlnqrlvpkiatrsqvngqsgrmdffwtilkpnd
    aihfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnihpl
    tigecpkyvksnklvlatglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hufB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypkyseeailkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records):
    >5hufB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypkyseeailkreeissg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hufC (C:)
    adlgsdqicigyhannstkqvdtimeknvtvthaqdilekthngklcdlngvkplilkdc
    svagwllgnpmcdefirvpewsyiveranpandlcypgtlndyeelkhllsrinhfektl
    iiprsswpnhetslgvsaacpyqgassffrnvvwlikkndayptikisynntnredllil
    wgihhsnnaaeqtnlyknpdtyvsvgtstlnqrlvpkiatrsqvngqsgrmdffwtilkp
    ndaihfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnih
    pltigecpkyvksnklvlatglrnsplrerrrkr
    

    Sequence, based on observed residues (ATOM records):
    >5hufC (C:)
    lgsdqicigyhannstkqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsv
    agwllgnpmcdefirvpewsyiveranpandlcypgtlndyeelkhllsrinhfektlii
    prsswpnhetslgvsaacpyqgassffrnvvwlikkndayptikisynntnredllilwg
    ihhsnnaaeqtnlyknpdtyvsvgtstlnqrlvpkiatrsqvngqsgrmdffwtilkpnd
    aihfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnihpl
    tigecpkyvksnklvlatglrnsp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hufD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypkyseeailkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records):
    >5hufD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypkyseeailkreeissg
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5hufE (E:)
    adlgsdqicigyhannstkqvdtimeknvtvthaqdilekthngklcdlngvkplilkdc
    svagwllgnpmcdefirvpewsyiveranpandlcypgtlndyeelkhllsrinhfektl
    iiprsswpnhetslgvsaacpyqgassffrnvvwlikkndayptikisynntnredllil
    wgihhsnnaaeqtnlyknpdtyvsvgtstlnqrlvpkiatrsqvngqsgrmdffwtilkp
    ndaihfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnih
    pltigecpkyvksnklvlatglrnsplrerrrkr
    

    Sequence, based on observed residues (ATOM records):
    >5hufE (E:)
    lgsdqicigyhannstkqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsv
    agwllgnpmcdefirvpewsyiveranpandlcypgtlndyeelkhllsrinhfektlii
    prsswpnhetslgvsaacpyqgassffrnvvwlikkndayptikisynntnredllilwg
    ihhsnnaaeqtnlyknpdtyvsvgtstlnqrlvpkiatrsqvngqsgrmdffwtilkpnd
    aihfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnihpl
    tigecpkyvksnklvlatglrnsp
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5hufF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypkyseeailkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records):
    >5hufF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypkyseeailkreeissg