PDB entry 5hua

View 5hua on RCSB PDB site
Description: Structure of C. glabrata FKBP12-FK506 complex
Class: isomerase
Keywords: FKBP12, fungal pathogen, FK506, self catalysis, ISOMERASE
Deposited on 2016-01-27, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FK506-binding protein 1
    Species: Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) [TaxId:284593]
    Gene: FPR1, CAGL0K09724g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5huaa_
  • Heterogens: FK5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5huaA (A:)
    amsetieggvkidrlspgdgktfpkqgdlvtihytgtlengqkfdssvdrgspfqcnigv
    gqvikgwdagipklsvgekarltipgpyaygprgfpglippnatlifdvellkvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5huaA (A:)
    setieggvkidrlspgdgktfpkqgdlvtihytgtlengqkfdssvdrgspfqcnigvgq
    vikgwdagipklsvgekarltipgpyaygprgfpglippnatlifdvellkvn