PDB entry 5hu8

View 5hu8 on RCSB PDB site
Description: The crystal structure of hemagglutinin from A/Sichuan/26221/2014 (H5N6) influenza virus
Class: viral protein
Keywords: hemagglutinin, influenza virus, H5N6, VIRAL PROTEIN
Deposited on 2016-01-27, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HU8
    Domains in SCOPe 2.07: d5hu8a1, d5hu8a2
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HU8
    Domains in SCOPe 2.07: d5hu8b_
  • Chain 'C':
    Compound: hemagglutinin HA1
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HU8
    Domains in SCOPe 2.07: d5hu8c1, d5hu8c2
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HU8
    Domains in SCOPe 2.07: d5hu8d_
  • Chain 'E':
    Compound: hemagglutinin HA1
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HU8
    Domains in SCOPe 2.07: d5hu8e1, d5hu8e2
  • Chain 'F':
    Compound: hemagglutinin HA2
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HU8
    Domains in SCOPe 2.07: d5hu8f_
  • Heterogens: NAG, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hu8A (A:)
    adlgsdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdc
    svagwllgnpmcdefirvpewsyiveranpandlcypgnlndyeelkhllsrinhfekil
    iipksswtnhetslgvsaacpyqgtpsffrnvvwlikkndayptikisynntnqedllil
    wgvhhsnnaaeqtnlyknpttyisvgtstlnqrlvpkiatrsqvngqrgrmdffwtilkp
    ndaihfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnih
    pltigecpkyvksnklvlatglrnsplrekrrkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hu8A (A:)
    sdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvag
    wllgnpmcdefirvpewsyiveranpandlcypgnlndyeelkhllsrinhfekiliipk
    sswtnhetslgvsaacpyqgtpsffrnvvwlikkndayptikisynntnqedllilwgvh
    hsnnaaeqtnlyknpttyisvgtstlnqrlvpkiatrsqvngqrgrmdffwtilkpndai
    hfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnihplti
    gecpkyvksnklvlatglrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hu8B (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnkcmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hu8B (B:)
    ggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgrefn
    nlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdnak
    elgngcfefyhkcdnkcmesvrngtydypqyseearlkreei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hu8C (C:)
    adlgsdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdc
    svagwllgnpmcdefirvpewsyiveranpandlcypgnlndyeelkhllsrinhfekil
    iipksswtnhetslgvsaacpyqgtpsffrnvvwlikkndayptikisynntnqedllil
    wgvhhsnnaaeqtnlyknpttyisvgtstlnqrlvpkiatrsqvngqrgrmdffwtilkp
    ndaihfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnih
    pltigecpkyvksnklvlatglrnsplrekrrkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hu8C (C:)
    sdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvag
    wllgnpmcdefirvpewsyiveranpandlcypgnlndyeelkhllsrinhfekiliipk
    sswtnhetslgvsaacpyqgtpsffrnvvwlikkndayptikisynntnqedllilwgvh
    hsnnaaeqtnlyknpttyisvgtstlnqrlvpkiatrsqvngqrgrmdffwtilkpndai
    hfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnihplti
    gecpkyvksnklvlatglrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hu8D (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnkcmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hu8D (D:)
    ggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgrefn
    nlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdnak
    elgngcfefyhkcdnkcmesvrngtydypqyseearlkreei
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hu8E (E:)
    adlgsdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdc
    svagwllgnpmcdefirvpewsyiveranpandlcypgnlndyeelkhllsrinhfekil
    iipksswtnhetslgvsaacpyqgtpsffrnvvwlikkndayptikisynntnqedllil
    wgvhhsnnaaeqtnlyknpttyisvgtstlnqrlvpkiatrsqvngqrgrmdffwtilkp
    ndaihfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnih
    pltigecpkyvksnklvlatglrnsplrekrrkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hu8E (E:)
    sdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvag
    wllgnpmcdefirvpewsyiveranpandlcypgnlndyeelkhllsrinhfekiliipk
    sswtnhetslgvsaacpyqgtpsffrnvvwlikkndayptikisynntnqedllilwgvh
    hsnnaaeqtnlyknpttyisvgtstlnqrlvpkiatrsqvngqrgrmdffwtilkpndai
    hfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnihplti
    gecpkyvksnklvlatglrn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hu8F (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnkcmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hu8F (F:)
    ggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgrefn
    nlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdnak
    elgngcfefyhkcdnkcmesvrngtydypqyseearlkreei