PDB entry 5htn

View 5htn on RCSB PDB site
Description: putative sugar kinases from synechococcus elongatus pcc7942-apo form
Deposited on 2016-01-27, released 2016-06-08
The last revision was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable sugar kinase
    Species: Synechococcus elongatus (strain PCC 7942) [TaxId:1140]
    Gene: Synpcc7942_2462
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5htnA (A:)
    mgmvvalgldfgtsgaraiacdfdsdrsvsvsvtfpktsqnwpqvwrealwqlltqipad
    wrsrieriaidgtsgtvllcdregqpqtepllynqacpidladladwvpadhaalsstss
    laklwfwqqqfgalppdwqilaqadwlslqlhgcsqqsdyhnalklgyspdrerfsknll
    dselgallpvvhepgvaigpilpaiaqefglspdcqicagttdsiaaflasgahqpgeav
    tslgstivlkllsqvavsdrltgvyshklggywltggasncggatlrqffpdteleslsc
    qidptkksgldyyplpsrgerfpiadpdrlpqleprpenpvqflqgllegltqvetlgyq
    rlqdlgatplkriwtagggaknavwqqlrqqaigvpiaiapnteaafgtarlaafglaaf
    hsaglkrtlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5htnA (A:)
    vvalgldfgtsgaraiacdfdsdrsvsvsvtfpktsqnwpqvwrealwqlltqipadwrs
    rieriaidgtsgtvllcdregqpqtepllynqacpidladladwvpadhaalsstsslak
    lwfwqqqfgalppdwqilaqadwlslqlhgcsqqsdyhnalklgyspdrerfsknlldse
    lgallpvvhepgvaigpilpaiaqefglspdcqicagttdsiaaflasgahqpgeavtsl
    gstivlkllsqvavsdrltgvyshklggywltggasncggatlrqffpdteleslscqid
    ptkksgldyyplpsrgerfpiadpdrlpqleprpenpvqflqgllegltqvetlgyqrlq
    dlgatplkriwtagggaknavwqqlrqqaigvpiaiapnteaafgtarlaafglaafh