PDB entry 5htg

View 5htg on RCSB PDB site
Description: Structure of apo P1 form of Candida albicans FKBP12
Class: isomerase
Keywords: FKBP12, pathogenic fungi, calcineurin, ISOMERASE
Deposited on 2016-01-26, released 2016-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FK506-binding protein 1
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: RBP1, RBP11, CaO19.11186, CaO19.3702, RBP2, RBP12, CaJ7.0299, CaO19.13810, CaO19.6452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5htga_
  • Chain 'B':
    Compound: FK506-binding protein 1
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: RBP1, RBP11, CaO19.11186, CaO19.3702, RBP2, RBP12, CaJ7.0299, CaO19.13810, CaO19.6452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5htgb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5htgA (A:)
    eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg
    wdisltnnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn
    gq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5htgB (B:)
    eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg
    wdisltnnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn
    gq