PDB entry 5htg
View 5htg on RCSB PDB site
Description: Structure of apo P1 form of Candida albicans FKBP12
Class: isomerase
Keywords: FKBP12, pathogenic fungi, calcineurin, ISOMERASE
Deposited on
2016-01-26, released
2016-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated
2016-09-14, with a file datestamp of
2016-09-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: FK506-binding protein 1
Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
Gene: RBP1, RBP11, CaO19.11186, CaO19.3702, RBP2, RBP12, CaJ7.0299, CaO19.13810, CaO19.6452
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5htga_ - Chain 'B':
Compound: FK506-binding protein 1
Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
Gene: RBP1, RBP11, CaO19.11186, CaO19.3702, RBP2, RBP12, CaJ7.0299, CaO19.13810, CaO19.6452
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5htgb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5htgA (A:)
eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg
wdisltnnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn
gq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5htgB (B:)
eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg
wdisltnnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn
gq