PDB entry 5ht9

View 5ht9 on RCSB PDB site
Description: Crystal structure of M-crystallin in the presence of nickel
Class: metal binding protein
Keywords: beta gamma crystallin, METAL BINDING PROTEIN
Deposited on 2016-01-26, released 2017-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta/gama crystallin family protein
    Species: Methanosarcina acetivorans C2A [TaxId:188937]
    Gene: MA_2526
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ht9a_
  • Chain 'B':
    Compound: Beta/gama crystallin family protein
    Species: Methanosarcina acetivorans C2A [TaxId:188937]
    Gene: MA_2526
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ht9b_
  • Heterogens: NI, MG, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ht9A (A:)
    naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
    gpgeyssvesagipdnsissfrqi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ht9B (B:)
    naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
    gpgeyssvesagipdnsissfrqi