PDB entry 5hsv

View 5hsv on RCSB PDB site
Description: x-ray structure of a cypa-alisporivir complex at 1.5 angstrom resolution
Deposited on 2016-01-26, released 2017-08-16
The last revision was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Chlorocebus aethiops [TaxId:9534]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Chlorocebus aethiops [TaxId:9534]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Chlorocebus aethiops [TaxId:9534]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Chlorocebus aethiops [TaxId:9534]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Alisporivir
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HSV (0-10)
  • Chain 'F':
    Compound: Alisporivir
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HSV (0-10)
  • Chain 'G':
    Compound: Alisporivir
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HSV (0-10)
  • Chain 'H':
    Compound: Alisporivir
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HSV (0-10)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hsvA (A:)
    gshmvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhrii
    pgfmcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqfficta
    ktewldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records):
    >5hsvA (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hsvB (B:)
    gshmvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhrii
    pgfmcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqfficta
    ktewldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records):
    >5hsvB (B:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgql
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hsvC (C:)
    gshmvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhrii
    pgfmcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqfficta
    ktewldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records):
    >5hsvC (C:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hsvD (D:)
    gshmvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhrii
    pgfmcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqfficta
    ktewldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records):
    >5hsvD (D:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >5hsvE (E:)
    taxxvlaallv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >5hsvF (F:)
    taxxvlaallv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >5hsvG (G:)
    taxxvlaallv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >5hsvH (H:)
    taxxvlaallv