PDB entry 5hsn

View 5hsn on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis marr family protein rv2887 complex with salicylic acid
Deposited on 2016-01-26, released 2017-02-01
Made obsolete by 5x80 on 2017-08-09

The last revision was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized HTH-type transcriptional regulator Rv2887
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv2887, MTCY274.18
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized HTH-type transcriptional regulator Rv2887
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv2887, MTCY274.18
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Uncharacterized HTH-type transcriptional regulator Rv2887
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv2887, MTCY274.18
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Uncharacterized HTH-type transcriptional regulator Rv2887
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv2887, MTCY274.18
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SAL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hsnA (A:)
    mgsshhhhhhssglvprgshmmgladdaplgyllyrvgavlrpevsaalsplgltlpefv
    clrmlsqspglssaelarhasvtpqamntvlrkledagavarpasvssgrslpatltarg
    ralakraeavvraadarvlarltapqqrefkrmleklgsd
    

    Sequence, based on observed residues (ATOM records):
    >5hsnA (A:)
    mgladdaplgyllyrvgavlrpevsaalsplgltlpefvclrmlsqspglssaelarhas
    vtpqamntvlrkledagavarpasvssgrslpatltargralakraeavvraadarvlar
    ltapqqrefkrmleklg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hsnB (B:)
    mgsshhhhhhssglvprgshmmgladdaplgyllyrvgavlrpevsaalsplgltlpefv
    clrmlsqspglssaelarhasvtpqamntvlrkledagavarpasvssgrslpatltarg
    ralakraeavvraadarvlarltapqqrefkrmleklgsd
    

    Sequence, based on observed residues (ATOM records):
    >5hsnB (B:)
    laddaplgyllyrvgavlrpevsaalsplgltlpefvclrmlsqspglssaelarhasvt
    pqamntvlrkledagavarpasvssgrslpatltargralakraeavvraadarvlarlt
    apqqrefkrmleklg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hsnC (C:)
    mgsshhhhhhssglvprgshmmgladdaplgyllyrvgavlrpevsaalsplgltlpefv
    clrmlsqspglssaelarhasvtpqamntvlrkledagavarpasvssgrslpatltarg
    ralakraeavvraadarvlarltapqqrefkrmleklgsd
    

    Sequence, based on observed residues (ATOM records):
    >5hsnC (C:)
    aplgyllyrvgavlrpevsaalsplgltlpefvclrmlsqspglssaelarhasvtpqam
    ntvlrkledagavarpasvssgrslpatltargralakraeavvraadarvlarltapqq
    refkrmleklgs
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hsnD (D:)
    mgsshhhhhhssglvprgshmmgladdaplgyllyrvgavlrpevsaalsplgltlpefv
    clrmlsqspglssaelarhasvtpqamntvlrkledagavarpasvssgrslpatltarg
    ralakraeavvraadarvlarltapqqrefkrmleklgsd
    

    Sequence, based on observed residues (ATOM records):
    >5hsnD (D:)
    daplgyllyrvgavlrpevsaalsplgltlpefvclrmlsqspglssaelarhasvtpqa
    mntvlrkledagavarpasvssgrslpatltargralakraeavvraadarvlarltapq
    qrefkrmleklg