PDB entry 5hsj

View 5hsj on RCSB PDB site
Description: structure of tyrosine decarboxylase complex with plp at 1.9 angstroms resolution
Deposited on 2016-01-25, released 2016-09-14
The last revision was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative decarboxylase
    Species: LACTOBACILLUS BREVIS [TaxId:1580]
    Gene: tdc, N624_0219
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative decarboxylase
    Species: LACTOBACILLUS BREVIS [TaxId:1580]
    Gene: tdc, N624_0219
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PLP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hsjA (A:)
    meksnrslkdldlnalfigdkaengqlykdllnklvdehlgwrknyipsdpnmigpedqn
    spafkktvghmktvldqlserirtesvpwhsagrywghmnsetlmpallaynyamlwngn
    nvayesspatsqmeeevgqefarlmgydygwghivadgslanleglwyarnikslpfamk
    evnpelvagksdwellnmptkeimdllenagsqidevkkrsarsgknlqrlgkwlvpqtk
    hyswmkaadiigigldqvvpvpidsnyrmdiqalesiirkyaaektpilgvvgvagstee
    gavdgidkivalrqklqkegiyfylhvdaayggyaralfldeddqfipyknlqkvhaenh
    vftedkeyikpevyaaykafdqaesitidphkmgyvpysaggiviqdirmrdtisyfaty
    vfekgadipallgayilegskagataasvwaahhtlplnvtgygklegasiegahryydf
    lknlkfevagkrisvhplispdfnmvdyvlkedgnddliemnrlnhafyeqasyvkgsly
    gkeyivshtdfaipdygdsplafveslgfsevewrhagkvtiirasvmtpymnqrenfdy
    faprikkaiqadlekvyasvnqkenvlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hsjA (A:)
    slkdldlnalfigdkaengqlykdllnklvdehlgwrknyipsdpnmigpedqnspafkk
    tvghmktvldqlserirtesvpwhsagrywghmnsetlmpallaynyamlwngnnvayes
    spatsqmeeevgqefarlmgydygwghivadgslanleglwyarnikslpfamkevnpel
    vagksdwellnmptkeimdllenagsqidevkkrsarsgknlqrlgkwlvpqtkhyswmk
    aadiigigldqvvpvpidsnyrmdiqalesiirkyaaektpilgvvgvagsteegavdgi
    dkivalrqklqkegiyfylhvdaayggyaralfldeddqfipyknlqkvhaenhvftedk
    eyikpevyaaykafdqaesitidphkmgyvpysaggiviqdirmrdtisyfagadipall
    gayilegskagataasvwaahhtlplnvtgygklegasiegahryydflknlkfevagkr
    isvhplispdfnmvdyvlkedgnddliemnrlnhafyeqasyvkgslygkeyivshtdfa
    ipdygdsplafveslgfsevewrhagkvtiirasvmtpymnqrenfdyfaprikkaiqad
    lekvya
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hsjB (B:)
    meksnrslkdldlnalfigdkaengqlykdllnklvdehlgwrknyipsdpnmigpedqn
    spafkktvghmktvldqlserirtesvpwhsagrywghmnsetlmpallaynyamlwngn
    nvayesspatsqmeeevgqefarlmgydygwghivadgslanleglwyarnikslpfamk
    evnpelvagksdwellnmptkeimdllenagsqidevkkrsarsgknlqrlgkwlvpqtk
    hyswmkaadiigigldqvvpvpidsnyrmdiqalesiirkyaaektpilgvvgvagstee
    gavdgidkivalrqklqkegiyfylhvdaayggyaralfldeddqfipyknlqkvhaenh
    vftedkeyikpevyaaykafdqaesitidphkmgyvpysaggiviqdirmrdtisyfaty
    vfekgadipallgayilegskagataasvwaahhtlplnvtgygklegasiegahryydf
    lknlkfevagkrisvhplispdfnmvdyvlkedgnddliemnrlnhafyeqasyvkgsly
    gkeyivshtdfaipdygdsplafveslgfsevewrhagkvtiirasvmtpymnqrenfdy
    faprikkaiqadlekvyasvnqkenvlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hsjB (B:)
    lkdldlnalfigdkaengqlykdllnklvdehlgwrknsdpnmigpedqnspafkktvgh
    mktvldqlserirtesvpwhsagrywghmnsetlmpallaynyamlwngnnvayesspat
    sqmeeevgqefarlmgydygwghivadgslanleglwyarnikslpfamkevnpelvagk
    sdwellnmptkeimdllenagsqidevkkrsarsgknlqrlgkwlvpqtkhyswmkaadi
    igigldqvvpvpidsnyrmdiqalesiirkyaaektpilgvvgvagsteegavdgidkiv
    alrqklqkegiyfylhvdaayggyaralfldeddqfipyknlqkvhaenhvftedkeyik
    pevyaaykafdqaesitidphkmgyvpysaggiviqdirmrdtisyfllgayilegskag
    ataasvwaahhtlplnvtgygklegasiegahryydflknlkfevagkrisvhplispdf
    nmvdyvlkedgnddliemnrlnhafyeqasyvkgslygkeyivshtdfaipdygdsplaf
    veslgfsevewrhagkvtiirasvmtpymnqrenfdyfaprikkaiqadlekvya