PDB entry 5hsf

View 5hsf on RCSB PDB site
Description: 1.52 Angstrom Crystal Structure of Fc fragment of Human IgG1.
Class: immune system
Keywords: Fc fragment, IgG1, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, IMMUNE SYSTEM
Deposited on 2016-01-25, released 2016-02-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-02-24, with a file datestamp of 2016-02-19.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hsfa_
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hsfb_
  • Heterogens: PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hsfA (A:)
    kakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppv
    ldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgksekdelgenl
    yfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hsfA (A:)
    gqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvlds
    dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hsfB (B:)
    kakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppv
    ldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgksekdelgenl
    yfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hsfB (B:)
    kakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppv
    ldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp