PDB entry 5hs7

View 5hs7 on RCSB PDB site
Description: Reduced form of the transcriptional regulator YodB from B. subtilis
Class: DNA binding protein
Keywords: HTH-type transcriptional regulator, reduced form, DNA BINDING PROTEIN
Deposited on 2016-01-25, released 2016-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator YodB
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: yodB, BSU19540
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34844 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.08: d5hs7a1, d5hs7a2
  • Chain 'B':
    Compound: HTH-type transcriptional regulator YodB
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: yodB, BSU19540
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34844 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.08: d5hs7b1, d5hs7b2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hs7A (A:)
    hmmcpkmesafsllgkrwngliihvlmdgpkrfkeitetipmisqkmlaerlkeleqnei
    verqvlpetpvkviytltekgtalqavfqemqawadqfcepgdtvceeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hs7A (A:)
    mmcpkmesafsllgkrwngliihvlmdgpkrfkeitetipmisqkmlaerlkeleqneiv
    erqvlpetpvkviytltekgtalqavfqemqawadqfcepgd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hs7B (B:)
    hmmcpkmesafsllgkrwngliihvlmdgpkrfkeitetipmisqkmlaerlkeleqnei
    verqvlpetpvkviytltekgtalqavfqemqawadqfcepgdtvceeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hs7B (B:)
    mmcpkmesafsllgkrwngliihvlmdgpkrfkeitetipmisqkmlaerlkeleqneiv
    erqvlpetpvkviytltekgtalqavfqemqawadqfc