PDB entry 5hs6

View 5hs6 on RCSB PDB site
Description: Human 17beta-hydroxysteroid dehydrogenase type 14 in complex with Estrone
Class: oxidoreductase
Keywords: 17bHSD14, Estrone complex, oxidoreductase
Deposited on 2016-01-25, released 2016-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17-beta-hydroxysteroid dehydrogenase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B14, DHRS10, SDR3, SDR47C1, UNQ502/PRO474
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BPX1 (Start-271)
      • expression tag (272)
    Domains in SCOPe 2.07: d5hs6a1, d5hs6a2
  • Heterogens: NAD, J3Z, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hs6A (A:)
    ghmatgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavf
    ilcdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgt
    ytltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvr
    vncispgniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfc
    tgiellvtggaelgygckasrstpvdapdipsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hs6A (A:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgygckapsg