PDB entry 5hs4

View 5hs4 on RCSB PDB site
Description: Plasmdoium Vivax Lactate dehydrogenase
Class: oxidoreductase
Keywords: malaria, lactate dehydrogenase, LDH, OXIDOREDUCTASE
Deposited on 2016-01-25, released 2016-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hs4a1, d5hs4a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hs4A (A:)
    mgsshhhhhhssglvprgshmenlyfqrgsmtpkpkivlvgsgmiggvmatlivqknlgd
    vvmfdvvknmpqgkaldtshsnvmaysnckvtgsnsyddlkgadvvivtagftkapgksd
    kewnrddllplnnkimieigghiknlcpnafiivvtnpvdvmvqllfehsgvpknkiigl
    ggvldtsrlkyyisqklnvcprdvnalivgahgnkmvllkryitvggiplqefinnkkit
    deevegifdrtvntaleivnllaspyvapaaaiiemaesylkdikkvlvcstllegqygh
    snifggtplviggtgveqvielqlnaeektkfdeavaetkrmkali
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hs4A (A:)
    kpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckvtg
    snsyddlkgadvvivtagfrddllplnnkimieigghiknlcpnafiivvtnpvdvmvql
    lfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivgahgnkmvllkryitv
    ggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaaaiiemaesylkdik
    kvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektkfdeavaetkrmkal
    i