PDB entry 5hrz

View 5hrz on RCSB PDB site
Description: computationally designed trimer 1na0c3_3
Deposited on 2016-01-24, released 2017-04-12
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TPR domain protein 1na0C3_3
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HRZ
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hrzA (A:)
    mnlaekmykagnamyrkgqytiaiiaytlallkdpnnaeawynlgnaaykkgeydeaiea
    yqkaleldpnnaeawynlgnayykqgdydeaieyyqkaleldpnnaeakqnlgnakqkqg
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hrzA (A:)
    nlaekmykagnamyrkgqytiaiiaytlallkdpnnaeawynlgnaaykkgeydeaieay
    qkaleldpnnaeawynlgnayykqgdydeaieyyqkaleldpnnaeakqnlgnakqkqgl
    eh