PDB entry 5hrr

View 5hrr on RCSB PDB site
Description: HIV Integrase Catalytic Domain containing F185K + A124N + T125S mutations complexed with GSK0002
Class: transferase/inhibitor
Keywords: Viral DNA integration, DNA Binding, LEDGF Binding, VIRAL PROTEIN, TRANSFERASE-INHIBITOR complex
Deposited on 2016-01-24, released 2016-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.8800000000000001 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585
      • conflict (74)
      • engineered mutation (75-76)
      • conflict (78)
      • engineered mutation (136)
    Domains in SCOPe 2.08: d5hrra_
  • Heterogens: CAC, SO4, EDO, 65P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hrrA (A:)
    gmhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrw
    pvktihtdngsnftsnsvkaacwwagikqefgipynpqsqgvvesmnkelkkiigqvrdq
    aehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hrrA (A:)
    cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
    dngsnftsnsvkaacwwagikqegvvesmnkelkkiigqvrdqaehlktavqmavfihnk
    krkgysagerivdiiatdiq