PDB entry 5hrj

View 5hrj on RCSB PDB site
Description: Crystal structure of the scavenger receptor cysteine-rich domain 5 (SRCR5) from porcine CD163
Class: endocytosis
Keywords: cd163, srcr, prrsv, balbes nmr, endocytosis
Deposited on 2016-01-23, released 2017-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Scavenger receptor cysteine-rich type 1 protein M130
    Species: Sus scrofa [TaxId:9823]
    Gene: CD163, M130
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hrja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5hrjA (A:)
prlvggdipcsgrvevqhgdtwgtvcdsdfsleaasvlcrelqcgtvvsllggahfgegs
gqiwaeefqcegheshlslcpvaprpdgtcshsrdvgvvcsvdhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >5hrjA (A:)
prlvggdipcsgrvevqhgdtwgtvcdsdfsleaasvlcrelqcgtvvsllggahfgegs
gqiwaeefqcegheshlslcpvaprpdgtcshsrdvgvvcs