PDB entry 5hrg

View 5hrg on RCSB PDB site
Description: the crystal structure of asfvpolx(d51n mutant):dna4 binary complex
Deposited on 2016-01-23, released 2017-01-18
The last revision was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase beta-like protein
    Species: African swine fever virus [TaxId:10497]
    Gene: O174L
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0A1E3N6 (4-177)
      • expression tag (1-3)
      • engineered mutation (54)
  • Chain 'B':
    Compound: DNA polymerase beta-like protein
    Species: African swine fever virus [TaxId:10497]
    Gene: O174L
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0A1E3N6 (4-177)
      • expression tag (1-3)
      • engineered mutation (54)
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*gp*ap*tp*cp*gp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: DNA (5'-d(*gp*cp*gp*ap*tp*cp*gp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hrgA (A:)
    sgggmltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvnlliiv
    pekkllkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhf
    tgpvsyliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl
    

    Sequence, based on observed residues (ATOM records):
    >5hrgA (A:)
    gggmltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvnlliivp
    ekkllkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhft
    gpvsyliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hrgB (B:)
    sgggmltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvnlliiv
    pekkllkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhf
    tgpvsyliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl
    

    Sequence, based on observed residues (ATOM records):
    >5hrgB (B:)
    gggmltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvnlliivp
    ekkllkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhft
    gpvsyliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.