PDB entry 5hre

View 5hre on RCSB PDB site
Description: the crystal structure of asfvpolx:dna3 binary complex
Deposited on 2016-01-23, released 2017-01-18
The last revision was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase beta-like protein
    Species: African swine fever virus [TaxId:10497]
    Gene: O174L
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA (5'-d(p*ap*gp*gp*ap*tp*cp*cp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: MN, FMT, PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hreA (A:)
    sgggmltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdlliiv
    pekkllkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhf
    tgpvsyliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl
    

    Sequence, based on observed residues (ATOM records):
    >5hreA (A:)
    gggmltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdlliivp
    ekkllkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhft
    gpvsyliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl
    

  • Chain 'B':
    No sequence available.