PDB entry 5hr9

View 5hr9 on RCSB PDB site
Description: the crystal structure of se-asfvpolx(l52/163m mutant) in complex with 1nt-gap dna1
Deposited on 2016-01-23, released 2017-01-18
The last revision was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase beta-like protein
    Species: African swine fever virus [TaxId:10497]
    Gene: O174L
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0A1E3N6 (4-177)
      • expression tag (2-3)
      • engineered mutation (55)
      • engineered mutation (166)
  • Chain 'B':
    Compound: DNA polymerase beta-like protein
    Species: African swine fever virus [TaxId:10497]
    Gene: O174L
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0A1E3N6 (4-177)
      • expression tag (3)
      • engineered mutation (55)
      • engineered mutation (166)
  • Chain 'C':
    Compound: DNA (5'-d(*gp*gp*ap*cp*ap*ap*cp*gp*gp*gp*ap*cp*ap*ap*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: DNA (5'-d(*gp*tp*tp*gp*tp*cp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'E':
    Compound: DNA (5'-d(*gp*tp*tp*gp*tp*cp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'F':
    Compound: DNA (5'-d(*gp*gp*ap*cp*ap*ap*cp*gp*gp*gp*ap*cp*ap*ap*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'G':
    Compound: DNA (5'-d(*gp*tp*tp*gp*tp*cp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'H':
    Compound: DNA (5'-d(*gp*tp*tp*gp*tp*cp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hr9A (A:)
    sgggmltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdmliiv
    pekkllkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhf
    tgpvsyliriraalkkknyklnqyglfknqtlvplkittekelikemgftyripkkrl
    

    Sequence, based on observed residues (ATOM records):
    >5hr9A (A:)
    ggmltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdmliivpe
    kkllkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhftg
    pvsyliriraalkkknyklnqyglfknqtlvplkittekelikemgftyripkkrl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hr9B (B:)
    sgggmltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdmliiv
    pekkllkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhf
    tgpvsyliriraalkkknyklnqyglfknqtlvplkittekelikemgftyripkkrl
    

    Sequence, based on observed residues (ATOM records):
    >5hr9B (B:)
    gmltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdmliivpek
    kllkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhftgp
    vsyliriraalkkknyklnqyglfknqtlvplkittekelikemgftyripkkrl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.