PDB entry 5hr1

View 5hr1 on RCSB PDB site
Description: Crystal structure of thioredoxin L107A mutant
Class: oxidoreductase
Keywords: E. coli thioredoxin, thiol-redox reactions, OXIDOREDUCTASE
Deposited on 2016-01-22, released 2017-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin-1
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: trxA, Z5291, ECs4714
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA27
      • engineered mutation (107)
    Domains in SCOPe 2.06: d5hr1a_
  • Chain 'B':
    Compound: Thioredoxin-1
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: trxA, Z5291, ECs4714
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA27
      • engineered mutation (107)
    Domains in SCOPe 2.06: d5hr1b_
  • Chain 'C':
    Compound: Thioredoxin-1
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: trxA, Z5291, ECs4714
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA27
      • engineered mutation (107)
    Domains in SCOPe 2.06: d5hr1c_
  • Chain 'D':
    Compound: Thioredoxin-1
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: trxA, Z5291, ECs4714
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA27
      • engineered mutation (107)
    Domains in SCOPe 2.06: d5hr1d_
  • Chain 'E':
    Compound: Thioredoxin-1
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: trxA, Z5291, ECs4714
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA27
      • engineered mutation (107)
    Domains in SCOPe 2.06: d5hr1e_
  • Chain 'F':
    Compound: Thioredoxin-1
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: trxA, Z5291, ECs4714
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA27
      • engineered mutation (107)
    Domains in SCOPe 2.06: d5hr1f_
  • Chain 'G':
    Compound: Thioredoxin-1
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: trxA, Z5291, ECs4714
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hr1A (A:)
    msdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvakln
    idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hr1A (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldana
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hr1B (B:)
    msdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvakln
    idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hr1B (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldana
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hr1C (C:)
    msdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvakln
    idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hr1C (C:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldana
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hr1D (D:)
    msdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvakln
    idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hr1D (D:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldana
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hr1E (E:)
    msdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvakln
    idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hr1E (E:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldana
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hr1F (F:)
    msdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvakln
    idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hr1F (F:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldana
    

  • Chain 'G':
    No sequence available.